Overview

  • Product name

    Recombinant Human DNMBP protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTLLSSQSSSLVAPSGSVSAENPEQRMLEKRAKVIEELLQTERDYIRDLE MCIERIMVPMQQAQVPNIDFEGLFGNTQMVIKVSKQLLAALEISDAVGPV FLGHRDELEGTYKIYCQNHDEAIALLEIYEKDEKIQKHLQDSLADLKSLY NEWGCTNYINLGSFLIKPVQRVMRYPLLLMELLNSTPESHPDKVPLTNAV LAVKEINVNINEYKRRKDLVLKYRKGDEDSLMEKISKLNIHSIIKKSNRV SSHLKHLTGFAPQIKDEVFEETEKNFRMQERLIKSFIRDLSLYLQHIRES ACVKVVAAVSMWDVCMERGHRDLEQFERVHRYISDQLFTNFKERTERLVI SPLNQLLSMFTGPHKLVQKRFDKLLDFYNCTERAEKLKDKKTLEELQSAR NNYEALNAQLLDELPKFHQYAQGLFTNCVHGYAEAHCDFVHQALEQLKPL LSLLKVAGREGNLIAIFHEEHSRVLQQLQVFTFFPESLPATKKPFERKTI DRQSARKPLLGLPSYMLQSEELRASLLARYPPEKLFQAERNFNAAQDLDV SLLEGDLVGVIKKKDPMGSQNRWLIDNGVTKGFVYSSFLKPYNPRRSHSD ASVGSHSSTESEHGSSSPRFPRQNSGSTLTFNPSSMAVSFTSGSCQKQPQ DASPPPKEWDQGTLSASLNPSNSESSPSRCPSDPDSTSQPRSGDSADVAR DVKQPTATPRSYRNFRHPEIVGYSVPGRNGQSQDLVKGCARTAQAPEDRS TEPDGSEAEGNQVYFAVYTFKARNPNELSVSANQKLKILEFKDVTGNTEW WLAEVNGKKGYVPSNYIRKTEYT
    • Molecular weight

      120 kDa including tags
    • Amino acids

      1 to 823

Specifications

Our Abpromise guarantee covers the use of ab132628 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Dnmbp
    • DNMBP_HUMAN
    • Dynamin binding protein
    • Dynamin-binding protein
    • KIAA1010
    • Scaffold protein Tuba
    • TUBA
    see all
  • Function

    Scaffold protein that links dynamin with actin-regulating proteins. May play a role in membrane trafficking between the cell surface and the Golgi.
  • Tissue specificity

    Detected in heart, brain, lung, liver, skeletal muscle, kidney and pancreas.
  • Sequence similarities

    Contains 1 BAR domain.
    Contains 1 DH (DBL-homology) domain.
    Contains 6 SH3 domains.
  • Cellular localization

    Cytoplasm. Golgi apparatus > Golgi stack. Cytoplasm > cytoskeleton. Cell junction > synapse. Localized to synapses and Golgi stacks.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132628 stained with Coomassie Blue.

References

ab132628 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132628.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up