Description

  • Product name

    Recombinant Human Dnmt1 protein
    See all Dnmt1 proteins and peptides
  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      PARTAPARVPTLAVPAISLPDDVRRRLKDLERDSLTEKECVKEKLNLLHE FLQTEIKNQLCDLETKLRKEELSEEGYLAKVKSLLNKDLSLENGAHAYNR EVNGRLENGNQARSEARRVGMADANSPPKPLSKPRTPRRSKSDGEAKRSR DPPASASQVTGIRAEPSPSPRITRKSTRQTTITSHFAKGPAKRKPQEESE RAKSDESIKEEDKDQDEKRRRVTSRERVARPLPAEEPERAKSGTRTEKEE ERDEKEEKRLRSQTKEPTPKQKLKEEPDREARAGVQADEDEDGDEKDEKK HRSQPKDLAAKRRPEEKEPEKVNPQISDEKDEDEKEEKRRKTTPKEPTEK KMARAKTVMNSKTHPPKCIQCGQYLDDPDLKYGQHPPDAVDEPQMLTNEK LSIFDANESGFESYEALPQHKLTCFSVYCKHGHLCPIDTGLIEKNIELFF SGSAKPIYDDDPSLEGGVNGKNLGPINEWWITGFDGGEKALIGFSTSFAE YILMDPSPEYAPIFGLMQEKIYISKIVVEFLQSNSDSTYEDLINKIETTV PPSGLNLNRFTEDSLLRHAQFVVEQVESYDEAGDSDEQPIFLTPCMRDLI KLAGVTLGQRRAQARRQTIRHSTREKDRGPTKATTTKLVYQIFDTFFAEQ IEKDDREDKENAFKRRRCGVCEVCQQPECGKCKACKDMVKFGGSGRSKQA CQERRCPNMAMKEADDDEEVDDNIPEMPSPKKMHQGKKKKQNKNRISWVG EAVKTDGKKSYYKKVCIDAETLEVGDCVSVIPDDSSKPLYLARVTALWED SSNGQMFHAHWFCAGTDTVLGATSDPLELFLVDECEDMQLSYIHSKVKVI YKAPSENWAMEGGMDPESLLEGDDGKTYFYQLWYDQDYARFESPPKTQPT EDNKFKFCVSCARLAEMRQKEIPRVLEQLEDLDSRVLYYSATKNGILYRV GDGVYLPPEAFTFNIKLSSPVKRPRKEPVDEDLYPEHYRKYSDYIKGSNL DAPEPYRIGRIKEIFCPKKSNGRPNETDIKIRVNKFYRPENTHKSTPASY HADINLLYWSDEEAVVDFKAVQGRCTVEYGEDLPECVQVYSMGGPNRFYF LEAYNAKSKSFEDPPNHARSPGNKGKGKGKGKGKPKSQACEPSEPEIEIK LPKLRTLDVFSGCGGLSEGFHQAGISDTLWAIEMWDPAAQAFRLNNPGST VFTEDCNILLKLVMAGETTNSRGQRLPQKGDVEMLCGGPPCQGFSGMNRF NSRTYSKFKNSLVVSFLSYCDYYRPRFFLLENVRNFVSFKRSMVLKLTLR CLVRMGYQCTFGVLQAGQYGVAQTRRRAIILAAAPGEKLPLFPEPLHVFA PRACQLSVVVDDKKFVSNITRLSSGPFRTITVRDTMSDLPEVRNGASALE ISYNGEPQSWFQRQLRGAQYQPILRDHICKDMSALVAARMRHIPLAPGSD WRDLPNIEVRLSDGTMARKLRYTHHDRKNGRSSSGALRGVCSCVEAGKAC DPAARQFNTLIPWCLPHTGNRHNHWAGLYGRLEWDGFFSTTVTNPEPMGK QGRVLHPEQHRVVSVRECARSQGFPDTYRLFGNILDKHRQVGNAVPPPLA KAIGLEIKLCMLAKARESASAKIKEEEAAKD
    • Predicted molecular weight

      211 kDa including tags
    • Amino acids

      2 to 1632
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      Isoform 2. NM_001130823

Specifications

Our Abpromise guarantee covers the use of ab198140 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 20% Glycerol, 0.63% Sodium chloride, 0.64% Tris HCl, 0.02% Potassium chloride, 0.04% Tween, 0.49% Glutathione, 0.05% DTT

General Info

  • Alternative names

    • ADCADN
    • AIM
    • CXXC finger protein 9
    • CXXC-type zinc finger protein 9
    • CXXC9
    • DNA (cytosine 5 ) methyltransferase 1
    • DNA (cytosine-5)-methyltransferase 1
    • DNA methyltransferase 1
    • DNA methyltransferase HsaI
    • DNA methyltransferase M.HsaI.
    • DNA MTase
    • DNA MTase HsaI
    • DNMT
    • DNMT 1
    • Dnmt1
    • DNMT1_HUMAN
    • Dnmt1o
    • FLJ16293
    • HSN1E
    • M.HsaI
    • MCMT
    • Met1
    • MGC104992
    • mMmul
    • MommeD2
    see all
  • Function

    Methylates CpG residues. Preferentially methylates hemimethylated DNA. Associates with DNA replication sites in S phase maintaining the methylation pattern in the newly synthesized strand, that is essential for epigenetic inheritance. Associates with chromatin during G2 and M phases to maintain DNA methylation independently of replication. It is responsible for maintaining methylation patterns established in development. DNA methylation is coordinated with methylation of histones. Mediates transcriptional repression by direct binding to HDAC2. In association with DNMT3B and via the recruitment of CTCFL/BORIS, involved in activation of BAG1 gene expression by modulating dimethylation of promoter histone H3 at H3K4 and H3K9.
  • Tissue specificity

    Ubiquitous; highly expressed in fetal tissues, heart, kidney, placenta, peripheral blood mononuclear cells, and expressed at lower levels in spleen, lung, brain, small intestine, colon, liver, and skeletal muscle. Isoform 2 is less expressed than isoform 1.
  • Sequence similarities

    Belongs to the C5-methyltransferase family.
    Contains 2 BAH domains.
    Contains 1 CXXC-type zinc finger.
  • Domain

    The N-terminal part is required for homodimerization and acts as a regulatory domain.
  • Post-translational
    modifications

    Sumoylated; sumoylation increases activity.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 4-20% SDS-PAGE Coomassie stained.

    Lane 1: 2 µg ab198140
    Lane 2: Protein Marker

  • Specific activity of ab198140 (1 hour at 37°C)

References

ab198140 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198140.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up