Recombinant human DNMT3B + DNMT3L protein (ab198124)

Description

  • Product name

    Recombinant human DNMT3B + DNMT3L protein
    See all DNMT3B + DNMT3L proteins and peptides
  • Biological activity

    Specific Activity: 0.52 pmol/min/μg.

     

  • Purity

    >= 79 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Amino Acid Sequence 1

    • Species

      Human
    • Sequence

      DNMT3B MHHHHHHYPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKV GKYVASEVCEESIAVGTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGG SPCNDLSNVNPARKGLYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFEN VVAMKVGDKRDISRFLECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIA SKNDKLELQDCLEYNRIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKED VLWCTELERIFGFPVHYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKD YFACE
    • Predicted molecular weight

      34 kDa including tags
    • Amino acids

      564 to 853
    • Tags

      His tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_006892
    • Amino Acid Sequence 2

    • Species

      Human
    • Sequence

      DNMT3L MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWR NKKFELGLEFPNLPYYIDGDVKLTQSMAIIRYIADKHNMLGGCPKERAEI SMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEMLKMFKDRLCHKTY LNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKY LKSSKYIAWPLQGWQATFGGGDHPPKSDPLVPRGSPGEFWRSQLKAFYDR ESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFLESGSDPGQLKH VVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWYLFQFHRLLQYA RPKPGSPRPFFWMFVDNLVLNKEDLDVASRFLEMEPVTIPDVHGGSLQNA VRVWSNIPAIRSSRHWALVSEEELSLLAQNKQSSKLAAKWPTKLVKNCFL PLREYFKYFSTELTSSL
    • Predicted molecular weight

      52 kDa including tags
    • Amino acids

      160 to 387
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      GenBank Accession No. NM_013369

Specifications

Our Abpromise guarantee covers the use of ab198124 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    ab198124 is a complex of DNMT3B and DNMT3L co-expressed in a baculovirus-infected Sf9 cell expression system.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.49% Glutathione, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • Specific activity of ab198124 was determined to be 0.52 pmol/min/μg

  • 4-20% SDS-PAGE analysis of 2.4 µg ab198124 with Coomassie staining.

References

ab198124 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198124.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up