Recombinant human DNMT3B + DNMT3L protein (ab198133)

Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence 1
    • Accession
    • Species

      Human
    • Sequence

      WRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLFEDIKKELTSLGFL ESGSDPGQLKHVVDVTDTVRKDVEEWGPFDLVYGATPPLGHTCDRPPSWY LFQFHRLLQYARPKPGSPRPFFWMFVDNLVLNKEDLDVASRFLEMEPVTI PDVHGGSLQNAVRVWSNIPAIRSSRHWALVSEEELSLLAQNKQSSKLAAK WPTKLVKNCFLPLREYFKYFSTELTSSL
    • Molecular weight

      27 kDa
    • Amino acids

      160 to 387
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NM_013369.
    Amino Acid Sequence 2
    • Accession
    • Species

      Human
    • Sequence

      YPAIPAARRRPIRVLSLFDGIATGYLVLKELGIKVGKYVASEVCEESIAV GTVKHEGNIKYVNDVRNITKKNIEEWGPFDLVIGGSPCNDLSNVNPARKG LYEGTGRLFFEFYHLLNYSRPKEGDDRPFFWMFENVVAMKVGDKRDISRF LECNPVMIDAIKVSAAHRARYFWGNLPGMNRPVIASKNDKLELQDCLEYN RIAKLKKVQTITTKSNSIKQGKNQLFPVVMNGKEDVLWCTELERIFGFPV HYTDVSNMGRGARQKLLGRSWSVPVIRHLFAPLKDYFACE
    • Molecular weight

      59 kDa including tags
    • Amino acids

      564 to 853
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      NM_006892.

Specifications

Our Abpromise guarantee covers the use of ab198133 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    Assayed using DNMT3B Assay Kit. Add 50 µl reaction mix containing DNMT3B/DNMT3L to wells coated with DNMT substrate. Incubate 2 hr at 37°C. Add antibody against 5-methylcytosine, then HRP-labeled secondary antibody followed by chemiluminescent detection.

  • Applications

    SDS-PAGE

    Functional Studies

  • Purity

    > 85 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.63% Tris HCl, 0.64% Sodium chloride, 0.02% Potassium chloride, 0.49% Glutathione, 20% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

Images

  • Functional assay of ab198133.

  • 10% SDS-PAGE analysis of ab198133 with Coomassie staining.

    Lane 1: ab198133
    Lane 2: Protein marker

References

ab198133 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab198133.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up