Overview

  • Product name

    Recombinant Human DOC2B protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MTLRRRGEKATISIQEHMAIDVCPGPIRPIKQISDYFPRFPRGLPPDAGP RAAAPPDAPARPAVAGAGRRSPSDGAREDDEDVDQLFGAYGSSPGPSPGP SPARPPAKPPEDEPDADGYESDDCTALGTLDFSLLYDQENNALHCTITKA KGLKPMDHNGLADPYVKLHLLPGASKANKLRTKTLRNTLNPTWNETLTYY GITDEDMIRKTLRISVCDEDKFRHNEFIGETRVPLKKLKPNHTKTFNICL EKQLPVDKTEDKSLEERGRILISLKYSSQKQGLLVGIVRCAHLAAMDANG YSDPYVKTYLRPDVDKKSKHKTAVKKKTLNPEFNEEFCYEIKHGDLAKKS LEVTVWDYDIGKSNDFIGGVVLGIHAKGERLKHWFDCLKNKDKRIERWHT LTSELPGAVLSD
    • Molecular weight

      72 kDa including tags
    • Amino acids

      1 to 412

Specifications

Our Abpromise guarantee covers the use of ab132855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Doc2 beta
    • Doc2-beta
    • Doc2b
    • DOC2B_HUMAN
    • DOC2BL
    • Double C2 like domain containing protein beta
    • Double C2 like domains beta
    • Double C2 like domains beta like
    • Double C2-like domain-containing protein beta
    • OTTMUSP00000006522
    • RP23 78H4.2
    see all
  • Function

    Calcium sensor which positively regulates SNARE-dependent fusion of vesicles with membranes. Binds phospholipids in a calcium-dependent manner and may act at the priming stage of fusion by modifying membrane curvature to stimulate fusion. Involved in calcium-triggered exocytosis in chromaffin cells and calcium-dependent spontaneous release of neurotransmitter in absence of action potentials in neuronal cells. Involved both in glucose-stimulated insulin secretion in pancreatic cells and insulin-dependent GLUT4 transport to the plasma membrane in adipocytes.
  • Tissue specificity

    Widely expressed with highest levels in brain and kidney. Expressed in pancreatic islet cells (at protein level).
  • Sequence similarities

    Contains 2 C2 domains.
  • Domain

    C2 domain 1 is involved in binding calcium and phospholipids. C2 domain 2 may also play a role in the calcium-dependent targeting to membranes.
  • Cellular localization

    Cytoplasm. Cytoplasmic granule. Cell membrane. Translocates to the plasma membrane in a calcium-dependent manner.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132855 stained with Coomassie Blue.

References

ab132855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up