Description

  • Product name

    Recombinant Human DOCK2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MCVCAEDGKTLPVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYV KLMKEDGTTLHDGFHDLVVLKGDSKKMEDASAYLTLPSYRHHVENKGATL SRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNVGLLGLLKWRMKPQLEES MRRLFESINNLMKSQYKTTILLQVAALKYIPSVLHDVEMVFDAKLLSQLL YEFYTCIPPVKLQKQKVQSMNEIVQSNLFKKQECRDILLPVITKELKELL EQKDDMQHQVLERKYCVELLNSILEVLSYQDAAFTYHHIQEIMVQLLRTV NRTVITMGRDHILIGACCNCGFPSSTPHSLIQWLWG
    • Predicted molecular weight

      63 kDa including tags
    • Amino acids

      1 to 336

Specifications

Our Abpromise guarantee covers the use of ab132560 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Dedicator of cyto kinesis 2
    • Dedicator of cytokinesis 2
    • Dedicator of cytokinesis protein 2
    • DOCK 2
    • FLJ46592
    • IMD40
    • KIAA0209
    see all
  • Relevance

    DOCK2 (dedicator of cytokinesis 2) is a hematopoietic cell-specific protein that participates in the cytoskeletal rearrangements required for lymphocyte migration in response to chemokines. DOCK2 activates the small GTPases RAC1 and RAC2 and may also be involved in IL2 transcriptional activation via the activation of RAC2.
  • Cellular localization

    Intracytoplasmic membrane. Peripheral membrane protein. Note=Colocalizes with F-actin.

Images

  • 12.5% SDS-PAGE analysis of ab132560 stained with Coomassie Blue.

References

ab132560 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132560.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up