Overview

  • Product name

    Recombinant Human DOCK7 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MACNQSAVYLQHCFATQRALVSKFPELLFEEETEQCADLCLRLLRHCSSS IGTIRSHASASLYLLMRQNFEIGNNFARVKMQVTMSLSSLVGTSQNFNEE FLRRSLKTILTYAEEDLELRETTFPDQVQDLVFNLHMILSDTVKMKEHQE DPEMLIDLMYRIAKGYQTSPDLRLTWLQNMAGKHSERSNHAEAAQCLVHS AALVAEYLSMLEDRKYLPVGCVTFQNISSNVLEESAVSDDVVSPDEEGIC SGKYFTESGLVGLLEQAAASFSMAGMYEAVNEVYKVLIPIHEANRDAKKL STIHGKLQEAFSKIVHQDGKRMFGTYFRVGFYGTKFGDLDEQEFVYKEPA ITKLAEISHRLEGFYGERFGEDVVEVIKDSNPVDKCKLDPNKAYIQITYV EPYFDTYEMKDRITYFDKNYNLRRFMYCTPFTLDGRAHGELHEQFKRKTI LTTSHAFPYIKTRVNVTHKEEIILTPIEVAIEDMQKKTQELAFATHQDPA DPKMLQMVLQGSVGTTVNQGPLEVAQVFLSEIPSDPKLFRHHNKLRLCFK DFTKRCEDALRKNKSLIGPDQKEYQRELERNYHRLKEALQPLINRKIPQL YKAVLPVTCHRDSFSRMSLRKMDL
    • Molecular weight

      98 kDa including tags
    • Amino acids

      1506 to 2129

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132790 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 3110056M06Rik
    • dedicator of cytokinesis 7
    • Dedicator of cytokinesis protein 7
    • Gm430
    • KIAA1771
    • MGC189434
    • mKIAA1771
    • RP23 329P19.2
    • ZIR2
    see all
  • Relevance

    DOCK7 functions as a guanine nucleotide exchange factor (GEF), which activates Rac1 and Rac3 Rho small GTPases by exchanging bound GDP for free GTP. It does not have a GEF activity for CDC42. It is required for STMN1 'Ser-15' phosphorylation during axon formation and consequently for neuronal polarization.
  • Cellular localization

    Cell projection, axon. Note=Enriched in the developing axons of hippocampal neurons.

Images

  • 12.5% SDS-PAGE analysis of ab132790 stained with Coomassie Blue.

References

ab132790 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132790.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up