Description

  • Product name

    Recombinant Human DOK2 protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGDGAVKQGFLYLQQQQTFGKKWRRFGASLYGGSDCALARLELQEGPEKP RRCGAARKVIRLSDCLRVAEAGGEASSPRDTSAFFLETKERLYLLAAPAA ERGDWVQAICLLAFPGQRKELSGPEGKQSRPCMEENELYSSAVTVGPHKE FAVTMRPTEASERCHLRGSYTLRAGESALELWGGPEPGTQLYDWPYRFLR RFGRDKVTFSFEAGRRCVSGEGNFEFETRQGNEIFLALEEAISAQKNAAP ATPQPQPATIPASLPRPDSPYSRPHDSLPPPSPTTPVPAPRPRGQEGEYA VPFDAVARSLGKNFRGILAVPPQLLADPLYDSIEETLPPRPDHIYDEPEG VAALSLYDSPQEPRGEAWRRQATADRDPAGLQHVQPAGQDFSASGWQPGT EYDNVVLKKGPK
    • Predicted molecular weight

      71 kDa including tags
    • Amino acids

      1 to 412

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131830 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Docking protein 2
    • Docking protein 2 56kDa
    • DOK 2
    • DOK R
    • DOK2
    • DOK2_HUMAN
    • Downstream of tyrosine kinase 2
    • OTTHUMP00000161710
    • OTTHUMP00000224923
    • p56(dok 2)
    • p56(dok-2)
    • p56DOK
    • p56dok 2
    • p56dok2
    see all
  • Function

    DOK proteins are enzymatically inert adaptor or scaffolding proteins. They provide a docking platform for the assembly of multimolecular signaling complexes. DOK2 may modulate the cellular proliferation induced by IL-4, as well as IL-2 and IL-3. May be involved in modulating Bcr-Abl signaling. Attenuates EGF-stimulated MAP kinase activation.
  • Tissue specificity

    Highly expressed in peripheral blood leukocytes, lymph nodes and spleen. Lower expression in thymus, bone marrow and fetal liver.
  • Sequence similarities

    Belongs to the DOK family. Type A subfamily.
    Contains 1 IRS-type PTB domain.
    Contains 1 PH domain.
  • Domain

    PTB domain mediates receptor interaction.
  • Post-translational
    modifications

    On immunoreceptor stimulation, phosphorylated on C-terminal tyrosine residues. Phosphorylation on Tyr-345 is required for binding to the SH2 domain of NCK. Phosphorylation on both Tyr-271 and Tyr-299 is required for interaction with RASGAP.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131830 stained with Coomassie Blue.

References

ab131830 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131830.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up