Description

  • Product name

    Recombinant Human DOK6 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASNFNDIVKQGYVKIRSRKLGIFRRCWLVFKKASSKGPRRLEKFPDEKA AYFRNFHKVTELHNIKNITRLPRETKKHAVAIIFHDETSKTFACESELEA EEWCKHLCMECLGTRLNDISLGEPDLLAAGVQREQNERFNVYLMPTPNLD IYGECTMQITHENIYLWDIHNAKVKLVMWPLSSLRRYGRDSTWFTFESGR MCDTGEGLFTFQTREGEMIYQKVHSATLAIAEQHERLMLEMEQKARLQTS LTEPMTLSKSISLPRSAYWHHITRQNSVGEIYSLQGHGFGSSKMSRAQTF PSYAPEQSEEAQQPLSRSSSYGFSYSSSLIQ
    • Amino acids

      1 to 331
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165951 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Docking protein 5
    • Docking protein 5 like
    • Docking protein 6
    • DOK 6
    • DOK5
    • DOK5L
    • DOK6
    • Downstream of tyrosine kinase 6
    • HsT3226
    • MGC20785
    • Protein dok 5
    see all
  • Relevance

    DOK6 (docking protein 6) is a novel member of the DOK4/5 subclass of the p62 DOK family of intracellular adaptor molecules. DOK6 is highly expressed in the developing central nervous system and is co expressed with Ret in several locations, including sympathetic, sensory, and parasympathetic ganglia, as well as in the ureteric buds of the developing kidneys. Pull down assays using the DOK6 phosphotyrosine binding (PTB) domain and GDNF activated Ret indicate that DOK6 binds to the phosphorylated Ret Tyr(1062) residue. Moreover, ligand activation of Ret resulted in phosphorylation of tyrosine residue(s) located within the unique C terminus of DOK6 predominantly through a Src dependent mechanism, indicating that DOK6 is a substrate of the Ret Src signaling pathway.

Images

  • ab165951 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165951 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165951.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up