Description

  • Product name

    Recombinant Human Dopamine beta Hydroxylase protein
  • Purity

    > 85 % SDS-PAGE.
    ab202616 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSAPRESPLPYHIPLDPEGSLELSWNVSYT QEAIHFQLLVRRLKAGVLFGMSDRGELENADLVVLWTDGDTAYFADAWSD QKGQIHLDPQQDYQLLQVQRTPEGLTLLFKRPFGTCDPKDYLIEDGTVHL VYGILEEPFRSLEAINGSGLQMGLQRVQLLKPNIPEPELPSDACTMEVQA PNIQIPSQETTYWCYIKELPKGFSRHHIIKYEPIVTKGNEALVHHMEVFQ CAPEMDSVPHFSGPCDSKMKPDRLNYCRHVLAAWALGAKAFYYPEEAGLA FGGPGSSRYLRLEVHYHNPLVIEGRNDSSGIRLYYTAKLRRFNAGIMELG LVYTPVMAIPPRETAFILTGYCTDKCTQLALPPSGIHIFASQLHTHLTGR KVVTVLVRDGREWEIVNQDNHYSPHFQEIRMLKKVVSVHPGDVLITSCTY NTEDRELATVGGFGILEEMCVNYVHYYPQTQLELCKSAVDAGFLQKYFHL INRFNNEDVCTCPQASVSQQFTSVPWNSFNRDVLKALYSFAPISMHCNKS SAVRFQGEWNLQPLPKVISTLEEPTPQCPTSQGRSPAGPTVVSIGGGKG
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      40 to 617
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_000778. Soluble Dopamine beta Hydroxylase.

Specifications

Our Abpromise guarantee covers the use of ab202616 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 89% PBS, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • dbh
    • DBM
    • Dopamine beta hydroxylase
    • Dopamine beta monooxygenase
    • Dopamine beta-hydroxylase (dopamine beta-monooxygenase)
    • Dopamine beta-monooxygenase
    • DOPO_HUMAN
    • OTTHUMP00000022501
    • Soluble dopamine beta-hydroxylase
    see all
  • Function

    Conversion of dopamine to noradrenaline.
  • Pathway

    Catecholamine biosynthesis; (R)-noradrenaline biosynthesis; (R)-noradrenaline from dopamine: step 1/1.
  • Involvement in disease

    Defects in DBH are the cause of dopamine beta-hydroxylase deficiency (DBH deficiency) [MIM:223360]; also known as norepinephrine deficiency or noradrenaline deficiency. This disorder is characterized by profound deficits in autonomic and cardiovascular function, but apparently only subtle signs, if any, of central nervous system dysfunction.
  • Sequence similarities

    Belongs to the copper type II ascorbate-dependent monooxygenase family.
    Contains 1 DOMON domain.
  • Cellular localization

    Cytoplasmic vesicle > secretory vesicle lumen. Cytoplasmic vesicle > secretory vesicle > chromaffin granule lumen and Cytoplasmic vesicle > secretory vesicle membrane. Cytoplasmic vesicle > secretory vesicle > chromaffin granule membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202616 (3 µg).

References

ab202616 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202616.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up