Recombinant Human DPAGT1 / GPT protein (ab158303)

Overview

  • Product name
    Recombinant Human DPAGT1 / GPT protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      IIPCPRHRIPRLNIKTGKLEMSYSKFKTKSLSFLGTFILKVAESLQLVTV HQSETEDGEFTECNNMTLINLLLKVLGPIHER
    • Amino acids
      296 to 377
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158303 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as DPAGT1. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • ALG7
    • AU021132
    • CDG Ij
    • CDG1J
    • CMS13
    • CMSTA2
    • D11S366
    • DGPT
    • Dolichyl phosphate (UDP N acetylglucosamine) acetylglucosaminephosphotransferase 1 (GlcNAc 1 P transferase)
    • Dolichyl-phosphate N-acetylglucosaminephosphotransferase 1
    • DPAGT1
    • DPAGT2
    • G1PT
    • GlcNAc 1 P transferase 1
    • GlcNAc-1-P transferase
    • Gnpta
    • GPT
    • GPT_HUMAN
    • H2afx
    • N-acetylglucosamine-1-phosphate transferase
    • UAGT
    • UDP GlcNAc:dolichyl phosphate N acetylglucosaminephosphotransferase
    • UDP N acetylglucosamine dolichyl phosphate N acetylglucosaminephosphotransferase 1
    • UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase
    • UGAT
    see all
  • Function
    Catalyzes the initial step in the synthesis of dolichol-P-P-oligosaccharides.
  • Pathway
    Protein modification; protein glycosylation.
  • Involvement in disease
    Defects in DPAGT1 are the cause of congenital disorder of glycosylation type 1J (CDG1J) [MIM:608093]. CDGs are a family of severe inherited diseases caused by a defect in protein N-glycosylation. They are characterized by under-glycosylated serum proteins. These multisystem disorders present with a wide variety of clinical features, such as disorders of the nervous system development, psychomotor retardation, dysmorphic features, hypotonia, coagulation disorders, and immunodeficiency. The broad spectrum of features reflects the critical role of N-glycoproteins during embryonic development, differentiation, and maintenance of cell functions.
  • Sequence similarities
    Belongs to the glycosyltransferase 4 family.
  • Cellular localization
    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • ab158303 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158303 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158303.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up