Overview

  • Product name

    Recombinant Human DPH2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MESMFSSPAEAALQRETGVPGLLTPLPDLDGVYELERVAGFVRDLGCERV ALQFPDQLLGDAVAVAARLEETTGSKMFILGDTAYGSCCVDVLGAEQAGA QALIHFGPACLSPPARPLPVAFVLRQRSVALELCVKAFEAQNPDPKAPVV LLSEPACAHALEALATLLRPRYLDLLVSSPAFPQPVGSLSPEPMPLERFG RRFPLAPGRRLEEYGAFYVGGSKASPDPDLDPDLSRLLLGWAPGQPFSSC CPDTGKTQDEGARAGRLRARRRYLVERARDARVVGLLAGTLGVAQHREAL AHLRNLTQAAGKRSYVLALGRPTPAKLANFPEVDVFVLLACPLGALAPQL SGSFFQPILAPCELEAACNPAWPPPGLAPHLTHYADLLPGSPFHVALPPP ESELWETPDVSLITGDLRPPPAWKSSNDHGSLALTPRPQLELAESSPAAS FLSSRSWQGLEPRLGQTPVTEAVSGRRGIAIAYEDEGSG
    • Amino acids

      1 to 489
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158306 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Diphthamide biosynthesis like protein 2
    • Diphthamide biosynthesis protein 2
    • Diphthamide biosynthesis protein 2 homolog like 2
    • Diphthamide biosynthesis protein 2 homolog-like 2
    • Diptheria toxin resistance protein required for diphthamide biosynthesis like 2
    • Diptheria toxin resistance protein required for diphthamide biosynthesis like 2 S. cerevisiae
    • DPH 2
    • DPH 2 homolog
    • DPH2
    • DPH2 homolog
    • DPH2 homolog S. cerevisiae
    • DPH2 like 2
    • DPH2 like 2 S. cerevisiae
    • DPH2-like 2
    • DPH2_HUMAN
    • DPH2L2
    • HsDph2
    • OTTHUMP00000010007
    • Protein DPH2 homolog
    see all
  • Function

    Required for the first step in the synthesis of diphthamide, a post-translational modification of histidine which occurs in translation elongation factor 2.
  • Tissue specificity

    Strongly expressed in skeletal muscle. Moderately expressed in heart, small intestine, liver, pancreas, testis and colon. Weakly expressed in brain, placenta, kidney, speen, thymus, prostate, ovary and lymphocytes.
  • Sequence similarities

    Belongs to the DPH1/DPH2 family. DPH2 subfamily.
  • Information by UniProt

Images

  • ab158306 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158306 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158306.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up