Description

  • Product name

    Recombinant Human DPM1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MASLEVSRGPRRSRRELEVRSPRQNKYSVLLPTYNERENLPLIVWLLVKS FSESGINYEIIIIDDGSPDGTRDVAEQLEKIYGSDRILLRPREKKLGLGT AYIHGMKHATGNYIIIMDADLSHHPKFIPEFIRKQKEGNFDIVSGTRYKG NGGVYGWDLKRKIISRGANFLTQILLRPGASDLTGSFRLYRKEVLEKLIE KCVSKGYVFQMEMIVRARQMNYTIGEVPISFVDRVYGESKLGGNEIVSFL KGLLTLFATT
    • Amino acids

      1 to 260
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152915 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CDGIE
    • dolichol monophosphate mannose synthase
    • Dolichol phosphate mannose synthase
    • Dolichol-phosphate mannose synthase
    • Dolichol-phosphate mannosyltransferase
    • Dolichyl phosphate beta D mannosyltransferase
    • dolichyl phosphate mannosyltransferase polypeptide 1
    • dolichyl phosphate mannosyltransferase polypeptide 1 catalytic subunit
    • Dolichyl-phosphate beta-D-mannosyltransferase
    • DPM synthase
    • DPM1
    • DPM1_HUMAN
    • Mannose P dolichol synthase
    • Mannose-P-dolichol synthase
    • MPD synthase
    • MPDS
    see all
  • Function

    Transfers mannose from GDP-mannose to dolichol monophosphate to form dolichol phosphate mannose (Dol-P-Man) which is the mannosyl donor in pathways leading to N-glycosylation, glycosyl phosphatidylinositol membrane anchoring, and O-mannosylation of proteins.
  • Pathway

    Protein modification; protein glycosylation.
  • Involvement in disease

    Defects in DPM1 are the cause of congenital disorder of glycosylation type 1E (CDG1E) [MIM:608799]. CDGs are metabolic deficiencies in glycoprotein biosynthesis that usually cause severe mental and psychomotor retardation. They are characterized by under-glycosylated serum glycoproteins. CDG1E is an autosomal recessive disorder, characterized by severe developmental delay, hypotnia, seizures, and dysmorphic features.
  • Sequence similarities

    Belongs to the glycosyltransferase 2 family.
  • Cellular localization

    Endoplasmic reticulum.
  • Information by UniProt

Images

  • ab152915 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab152915 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152915.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up