Description

  • Product name

    Recombinant Human DPP10 protein
    See all DPP10 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      LTPDELTNSSETRLSLEDLFRKDFVLHDPEARWINDTDVVYKSENGHVIK LNIETNATTLLLENTTFVTFKASRHSVSPDLKYVLLAYDVKQIFHYSYTA SYVIYNIHTREVWELNPPEVEDSVLQYAAWGVQGQQLIYIFENNIYYQPD IKSSSLRLTSSGKEEIIFNGIADWLYEEELLHSHIAHWWSPDGERLAFLM INDSLVPTMVIPRFTGALYPKGKQYPYPKAGQMNPTIKLYVVNLYGPTHT LELMPPDSFKSREYYITMVKWVSNTKTVVRWLNRAQNISILTVCETTTGA CSKKYEMTSDTWLSQQNEEPVFSRDGSKFFMTVPVKQGGRGEFHHIAMFL IQSKSEQITVRHLTSGNWEVIKILAYDETTQKIYFLSTESSPRGRQLYSA STEGLLNRQCISCNFMKEQCTYFDASFSPMNQHFLLFCEGPRVPVVSLHS TDNPAKYFILESNSMLKEAILKKKIGKPEIKILHIDDYELPLQLSLPKDF MDRNQYALLLIMDEEPGGQLVTDKFHIDWDSVLIDMDNVIVARFDGRGSG FQGLKILQEIHRRLGSVEVKDQITAVKFLLKLPYIDSKRLSIFGKGYGGY IASMILKSDEKLFKCGSVVAPITDLKLYASAFSERYLGMPSKEESTYQAA SVLHNVHGLKEENILIIHGTADTKVHFQHSAELIKHLIKAGVNYTMQVYP DEGHNVSEKSKYHLYSTILKFFSDCLKEEISVLPQEPEEDEVDHHHHHH
    • Predicted molecular weight

      86 kDa including tags
    • Amino acids

      56 to 796
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain.

Specifications

Our Abpromise guarantee covers the use of ab192285 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 0.87% Sodium chloride, 99% Phosphate Buffer

    Lyophilized from a 0.2 µM filtered solution.

General Info

  • Alternative names

    • Dipeptidyl peptidase 10
    • Dipeptidyl peptidase 10 non functional
    • Dipeptidyl peptidase IV related protein 3
    • Dipeptidyl peptidase IV-related protein 3
    • Dipeptidyl peptidase like protein 2
    • Dipeptidyl peptidase X
    • Dipeptidyl peptidase-like protein 2
    • Dipeptidylpeptidase 10
    • DPL 2
    • DPL2
    • DPP 10
    • DPP X
    • Dpp10
    • DPP10_HUMAN
    • DPPY
    • DPRP 3
    • DPRP-3
    • DPRP3
    • Inactive dipeptidyl peptidase 10
    • KIAA1492
    see all
  • Function

    Has no dipeptidyl aminopeptidase activity. May modulate cell surface expression and activity of the potassium channels KCND1 and KCND2.
  • Tissue specificity

    Found in serum, T-cells and brain (at protein level). Expressed in brain, pancreas, spinal cord and adrenal glands.
  • Involvement in disease

    Genetic variations in DPP10 are associated with susceptibility to asthma (ASTHMA) [MIM:600807]. The most common chronic disease affecting children and young adults. It is a complex genetic disorder with a heterogeneous phenotype, largely attributed to the interactions among many genes and between these genes and the environment. It is characterized by recurrent attacks of paroxysmal dyspnea, with weezing due to spasmodic contraction of the bronchi.
  • Sequence similarities

    Belongs to the peptidase S9B family. DPPIV subfamily.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

References

ab192285 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab192285.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up