Overview

  • Product name

    Recombinant Human Dppa2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSDANLDSSKKNFLEGEVDDEESVILTLVPVKDDANMEQMEPSVSSTSDV KLEKPKKYNPGHLLQTNEQFTAPQKARCKIPALPLPTILPPINKVCRDTL RDWCQQLGLSTNGKKIEVYLRLHRHAYPEQRQDMPEMSQETRLQRCSRKR KAVTKRARLQRSYEMNERAEETNTVEVITSAPGAMLASWARIAARAVQPK ALNSCSIPVSVEAFLMQASGVRWCVVHGRLLSADTKGWVRLQFHAGQAWV PTTHRRMISLFLLPACIFPSPGIEDNMLCPDCAKRNKKMMKRLMTVEK
    • Molecular weight

      60 kDa including tags
    • Amino acids

      1 to 298

Specifications

Our Abpromise guarantee covers the use of ab133004 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • cancer/testis antigen 100
    • CT100
    • Developmental Pluripotency Associated 2
    • developmental pluripotency-associated gene 2
    • developmental pluripotency-associated protein 2
    • ECAT15-2
    • embryonic stem cell (ESC) associated transcript 15-2
    • PESCRG1
    • Pluripotent embryonic stem cell related protein 1
    • Pluripotent embryonic stem cell-related gene 1
    • Pluripotent embryonic stem cell-related gene 1 protein
    see all
  • Relevance

    Dppa2 is a SAP domain protein expressed only in pluripotent cells and the developing germ line.
  • Cellular localization

    Nuclear

Images

  • 12.5% SDS-PAGE analysis of ab133004 stained with Coomassie Blue.

References

ab133004 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab133004.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up