Description

  • Product name

    Recombinant Human DPY30 protein
  • Purity

    >= 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EPEQMLEGQTQVAENPHSEYGLTDNVERIVENEKINAEKSSKQKVDLQSL PTRAYLDQTVVPILLQGLAVLAKERPPNPIEFLASYLLKNKAQFEDRN
    • Predicted molecular weight

      12 kDa including tags
    • Amino acids

      2 to 99
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab135020 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.53% Imidazole
    Constituents: 0.00001% Zinc chloride, 0.02% Potassium chloride, 0.71% Tris HCl, 10% Glycerol, 0.73% Sodium chloride, 0.03% TCEP

General Info

  • Alternative names

    • Dpy-30-like protein
    • Dpy-30L
    • DPY30
    • DPY30_HUMAN
    • HDPY-30
    • Protein dpy-30 homolog
    • Saf19
    see all
  • Function

    As part of the MLL1/MLL complex it is involved in methylation and dimethylation at 'Lys-4' of histone H3. H3 'Lys-4' methylation represents a specific tag for epigenetic transcriptional activation. May also play an indirect or direct role in endosomal transport.
  • Sequence similarities

    Belongs to the dpy-30 family.
  • Cellular localization

    Nucleus. Golgi apparatus > trans-Golgi network.
  • Information by UniProt

Images

  • 10% SDS-PAGE analysis of ab135020 (19 µg) stained with Coomassie Blue.

References

ab135020 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135020.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up