Overview

Description

  • Nature
    Recombinant
  • Source
    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCP QDTFLAWENHHNSECARCQACDEQASQVALENCSAVADTRCGCKPGWFVE CQVSQCVSSSPFYCQPCLDCGALHRHTRLLCSRRDTDCGTCLPGFYEHGD GCVSCPTSTLGSCPERCAAVCGWRQ
    • Molecular weight
      55 kDa
    • Amino acids
      25 to 199

Associated products

Specifications

Our Abpromise guarantee covers the use of ab157260 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 0.100 Eu/µg
  • Purity
    >95% by SDS-PAGE .

  • Form
    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20ºC.

    Constituent: 99% PBS

  • Reconstitution
    Reconstitute with 50µl sterile water. Further dilutions should be made with medium containing 5% fetal calf serum or a carrier protein. After reconstitution, it is recommended to make appropriate aliquots and to store them at -20°C. Avoid freeze/thaw cycles.

General Info

  • Alternative names
    • Apo 3
    • Apo-3
    • Apo3
    • Apoptosis inducing receptor
    • Apoptosis inducing receptor AIR
    • Apoptosis mediating receptor
    • Apoptosis mediating receptor DR 3
    • Apoptosis mediating receptor DR3
    • Apoptosis mediating receptor TRAMP
    • Apoptosis-inducing receptor AIR
    • Apoptosis-mediating receptor DR3
    • Apoptosis-mediating receptor TRAMP
    • DDR 3
    • DDR3
    • Death domain receptor 3
    • Death domain receptor 3 soluble form
    • Death receptor 3
    • Death receptor beta
    • DR 3
    • DR3
    • LARD
    • Lymphocyte associated receptor of death
    • Lymphocyte-associated receptor of death
    • Protein WSL
    • Protein WSL-1
    • TNF receptor superfamily member 25
    • TNFR25
    • TNFRSF 12
    • TNFRSF 25
    • TNFRSF12
    • TNFRSF12, formerly
    • TNFRSF25
    • TNR25_HUMAN
    • TR 3
    • TR3
    • TRAMP
    • Translocating chain association membrane protein
    • Tumor necrosis factor receptor superfamily member 12
    • Tumor necrosis factor receptor superfamily member 25
    • Tumor necrosis factor receptor superfamily, member 12 (translocating chain association membrane protein)
    • Tumor necrosis factor receptor superfamily, member 12, formerly
    • WSL
    • WSL 1
    • WSL LR
    • WSL protein
    • WSL1
    • WSL1 protein
    • WSLLR
    see all
  • Function
    Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.
  • Tissue specificity
    Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate.
  • Sequence similarities
    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications
    Glycosylated.
  • Cellular localization
    Secreted and Cell membrane.
  • Information by UniProt

References

ab157260 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab157260.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up