Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QGGTRSPRCDCAGDFHKKIGLFCCRGCPAGHYLKAPCTEPCGNSTCLVCP QDTFLAWENH HNSECARCQACDEQASQVALENCSAVADTRCGCKPGWF VECQVSQCVSSSPFYCQPCLDC GALHRHTRLLCSRRDTDCGTCLPGFY EHGDGCVSCPTSTLGSCPERCAAVCGWRQ
    • Molecular weight

      46 kDa including tags
    • Amino acids

      25 to 199
    • Additional sequence information

      Extracellular domain fused with a human IgG1 Fc tag at the C-terminus (AAI17190).

Specifications

Our Abpromise guarantee covers the use of ab220592 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as DR3

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.50
    Constituents: 0.61% Tris, 0.75% Glycine, 5% Trehalose, Sodium chloride, L-Arginine

    Lyophilized from 0.22 µm filtered solution.
    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%

  • Reconstitution
    It is recommended to reconstitute the lyophilized protein in sterile deionized water to a final concentration of 1mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • Apo 3
    • Apo-3
    • Apo3
    • Apoptosis inducing receptor
    • Apoptosis inducing receptor AIR
    • Apoptosis mediating receptor
    • Apoptosis mediating receptor DR 3
    • Apoptosis mediating receptor DR3
    • Apoptosis mediating receptor TRAMP
    • Apoptosis-inducing receptor AIR
    • Apoptosis-mediating receptor DR3
    • Apoptosis-mediating receptor TRAMP
    • DDR 3
    • DDR3
    • Death domain receptor 3
    • Death domain receptor 3 soluble form
    • Death receptor 3
    • Death receptor beta
    • DR 3
    • DR3
    • LARD
    • Lymphocyte associated receptor of death
    • Lymphocyte-associated receptor of death
    • Protein WSL
    • Protein WSL-1
    • TNF receptor superfamily member 25
    • TNFR25
    • TNFRSF 12
    • TNFRSF 25
    • TNFRSF12
    • TNFRSF12, formerly
    • TNFRSF25
    • TNR25_HUMAN
    • TR 3
    • TR3
    • TRAMP
    • Translocating chain association membrane protein
    • Tumor necrosis factor receptor superfamily member 12
    • Tumor necrosis factor receptor superfamily member 25
    • Tumor necrosis factor receptor superfamily, member 12 (translocating chain association membrane protein)
    • Tumor necrosis factor receptor superfamily, member 12, formerly
    • WSL
    • WSL 1
    • WSL LR
    • WSL protein
    • WSL1
    • WSL1 protein
    • WSLLR
    see all
  • Function

    Receptor for TNFSF12/APO3L/TWEAK. Interacts directly with the adapter TRADD. Mediates activation of NF-kappa-B and induces apoptosis. May play a role in regulating lymphocyte homeostasis.
  • Tissue specificity

    Abundantly expressed in thymocytes and lymphocytes. Detected in lymphocyte-rich tissues such as thymus, colon, intestine, and spleen. Also found in the prostate.
  • Sequence similarities

    Contains 1 death domain.
    Contains 4 TNFR-Cys repeats.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Secreted and Cell membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of reduced ab220592 stained overnight with Coomassie Blue.

    DTT-reduced Protein migrates as 55 kDa in SDS-PAGE due to glycosylation.

References

ab220592 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab220592.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up