Overview

Description

  • Nature
    Recombinant
  • Source
    Baculovirus infected insect cells
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      ASGTEAAAATPSKVWGSSAGRIEPRGGGRGALPTSMGQHGPSARARAGRA PGPRPAREASPRLRVHKTFKFVVVGVLLQVVPSSAATIKLHDQSIGTQQW EHSPLGELCPPGSHRSEHPGACNRCTEGVGYTNASNNLFACLPCTACKSD EEERSPCTTTRNTACQCKPGTFRNDNSAEMCRKCSRGCPRGMVKVKDCTP WSDIECVHKESGNGHNLEHHHHHH
    • Molecular weight
      24 kDa including tags
    • Amino acids
      24 to 239
    • Tags
      His tag C-Terminus
    • Additional sequence information
      Extracellular domain (NP_003835).

Specifications

Our Abpromise guarantee covers the use of ab227389 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Endotoxin level
    < 1.000 Eu/µg
  • Purity
    >90% by SDS-PAGE.
    ab227389 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names
    • Apo2
    • CD261
    • Cytotoxic TRAIL receptor
    • Death receptor 4
    • DR4
    • NF related apoptosis-inducing ligand receptor 1
    • TNF receptor superfamily member 10a
    • TNF-related apoptosis-inducing ligand receptor 1
    • TNFRSF10A
    • TR10A_HUMAN
    • TRAIL receptor 1
    • TRAIL-R1
    • TRAILR 1
    • TRAILR1
    • Tumor necrosis factor receptor superfamily member 10A
    • Tumor necrosis factor receptor superfamily member 10a variant 2
    • Tumor necrosis factor receptor superfamily, member 10a
    see all
  • Function
    Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B.
  • Tissue specificity
    Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K562 erythroleukemia cells, MCF7 breast carcinoma cells and activated T-cells.
  • Sequence similarities
    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization
    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab227389.

    MW: 18-28 kDa (SDS-PAGE under reducing conditions).

References

ab227389 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab227389.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up