Bioactive grade

Recombinant human DR5 protein (Active) (Biotin) (ab246172)

Description

  • Product name

    Recombinant human DR5 protein (Active) (Biotin)
    See all DR5 proteins and peptides
  • Biological activity

    Immobilized Recombinant human TNFSF10 at 5 μg/mL (100 μL/well) can bind ab246172 with a linear range of 2-156 ng/mL.

  • Purity

    > 90 % SDS-PAGE.
    The biotin to protein ratio is 0.5-1 as determined by the HABA assay.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYST HWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRK CRTGCPRGMVKVGDCTPWSDIECVHKE
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      56 to 182
    • Tags

      His tag C-Terminus , Avi tag C-Terminus
    • Additional sequence information

      AviTag sequence GLNDIFEAQKIEWHE.
  • Conjugation

    Biotin

Specifications

Our Abpromise guarantee covers the use of ab246172 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Functional Studies

  • Form

    Lyophilised
  • Additional notes

    Biotinylation of this product is performed using Avitag™ technology. Briefly, the single lysine residue in the Avitag is enzymatically labeled with biotin.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon reconsitution add a carrier protein (0.1% BSA). Store at -20°C or -80°C. Avoid freeze / thaw cycle. Store In the Dark.

    pH: 7.4
    Constituents: PBS, 5% Trehalose

    0.22 µm filtered

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended to reconstitute the lyophilized product in sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long-term storage.

General Info

  • Alternative names

    • Fas like protein
    • Apoptosis inducing protein TRICK2A/2B
    • Apoptosis inducing receptor TRAIL R2
    • CD262
    • CD262 antigen
    • Cytotoxic TRAIL receptor 2
    • Death domain containing receptor for TRAIL/Apo 2L
    • Death receptor 5
    • DR5
    • KILLER
    • KILLER/DR5
    • OTTHUMP00000123492
    • OTTHUMP00000123493
    • p53 regulated DNA damage inducible cell death receptor(killer)
    • TNF related apoptosis inducing ligand receptor 2
    • TNF-related apoptosis-inducing ligand receptor 2
    • TNFRSF10B
    • TR10B_HUMAN
    • TRAIL R2
    • TRAIL receptor 2
    • TRAIL-R2
    • TRAILR2
    • TRICK2
    • TRICK2A
    • TRICK2B
    • TRICKB
    • Tumor necrosis factor receptor like protein ZTNFR9
    • Tumor necrosis factor receptor superfamily member 10B
    • Tumor necrosis factor receptor superfamily, member 10b
    • ZTNFR9
    see all
  • Function

    Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
  • Tissue specificity

    Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus, placenta, testis, esophagus, stomach and throughout the intestinal tract; not detectable in brain.
  • Involvement in disease

    Squamous cell carcinoma of the head and neck
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant human DR5 protein (Active) (Biotin) (ab246172).

    The gel was stained overnight with Coomassie Blue.

    The protein migrates as 22 kDa and 24 kDa under reducing conditions due to glycosylation.

  • Immobilized Recombinant human TNFSF10 at 5 μg/mL (100 μL/well) can bind ab246172 with a linear range of 2-156 ng/mL.

References

ab246172 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab246172.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up