Description

  • Product name

    Recombinant human DR5 protein (Fc Chimera)
    See all DR5 proteins and peptides
  • Biological activity

    The ED50 of DR5 Fc Chimera is typically 38-40 ng/ml as measured by its ability to neutralize TRAIL mediated cytotoxicity using the human leukemic Jurkat cells.
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      Theoretical sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDC ISCKYGQDY STHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEG TFREEDSPE MCRKCRTGCPRGMVKVGDCTPWSDIECVHKEGSSNTKVD KKVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids

      56 to 182
    • Additional sequence information

      Encodes the signal peptide and extracellular domain of human TRAIL R2 (aa 1-182) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells.

Associated products

Specifications

Our Abpromise guarantee covers the use of ab83547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Constituents: 1% Human serum albumin, 10% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.

General Info

  • Alternative names

    • Fas like protein
    • Apoptosis inducing protein TRICK2A/2B
    • Apoptosis inducing receptor TRAIL R2
    • CD262
    • CD262 antigen
    • Cytotoxic TRAIL receptor 2
    • Death domain containing receptor for TRAIL/Apo 2L
    • Death receptor 5
    • DR5
    • KILLER
    • KILLER/DR5
    • OTTHUMP00000123492
    • OTTHUMP00000123493
    • p53 regulated DNA damage inducible cell death receptor(killer)
    • TNF related apoptosis inducing ligand receptor 2
    • TNF-related apoptosis-inducing ligand receptor 2
    • TNFRSF10B
    • TR10B_HUMAN
    • TRAIL R2
    • TRAIL receptor 2
    • TRAIL-R2
    • TRAILR2
    • TRICK2
    • TRICK2A
    • TRICK2B
    • TRICKB
    • Tumor necrosis factor receptor like protein ZTNFR9
    • Tumor necrosis factor receptor superfamily member 10B
    • Tumor necrosis factor receptor superfamily, member 10b
    • ZTNFR9
    see all
  • Function

    Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
  • Tissue specificity

    Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus, placenta, testis, esophagus, stomach and throughout the intestinal tract; not detectable in brain.
  • Involvement in disease

    Squamous cell carcinoma of the head and neck
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • Lane 1 – MW markers; Lane 2 – ab83547; Lane 3 – ab83547 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83547 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 μg of protein was loaded per lane; Gel was stained using Coomassie.
    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
  • A sample of ab83547 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Approximately 40 μg of protein was loaded; Gel was stained using Deep Purple™. The spot train indicates the presence of multiple isoforms of ab83547. Spots within the spot train were cut from the gel and identified as ab83547 by protein mass fingerprinting.
  • Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates that ab83547 exists in multiple isoforms, which differ according to their level of post-translational modification. Expression of these isoforms is highly significant for cell biology, as they more closely resemble the native human proteins.
    The triangle indicates theoretical pI and MW of the protein.

References

ab83547 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Answer


These proteins are all Fc-fusions of different fragments of DR5. Ab83547 contains amino acids 56-182, ab56519 contains amino acids 1-182, and ab109149 contains amino acids 52-212. Because of these different sequences, the functionality may vary among the proteins.
Ab56519 has not been tested for functionality, but the other two proteins have been shown to neutralize TRAIL activity, and we fully guarantee them to do so.

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up