For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-dr5-protein-fc-chimera-ab83547.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cell Biology Apoptosis Receptors Death Receptors
Share by email

Recombinant human DR5 protein (Fc Chimera) (ab83547)

  • Datasheet
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

SDS-PAGE - Recombinant human DR5 protein (Fc Chimera) (ab83547)
  • SDS-PAGE - Recombinant human DR5 protein (Fc Chimera) (ab83547)
  • Functional Studies - Recombinant human DR5 protein (Fc Chimera) (ab83547)

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Active: Yes
  • Suitable for: Functional Studies, SDS-PAGE

You may also be interested in

ELISA
Product image
Human TRAIL R2 ELISA Kit (ab233614)
Pair
Product image
Human TRAIL R2 Antibody Pair - BSA and Azide free (ab244087)

View more associated products

Description

  • Product name

    Recombinant human DR5 protein (Fc Chimera)
    See all DR5 proteins and peptides
  • Biological activity

    The ED50 of DR5 Fc Chimera is typically 38-40 ng/ml as measured by its ability to neutralize TRAIL mediated cytotoxicity using the human leukemic Jurkat cells.
  • Purity

    > 95 % SDS-PAGE.

  • Expression system

    HEK 293 cells
  • Accession

    O14763
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      Theoretical sequence: ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDC ISCKYGQDY STHWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEG TFREEDSPE MCRKCRTGCPRGMVKVGDCTPWSDIECVHKEGSSNTKVD KKVEPKSCD KTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVT CVVVDVSHE DPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTV LHQDWLNGK EYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD ELTKNQVSL TCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSF FLYSKLTVD KSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
    • Amino acids

      56 to 182
    • Additional sequence information

      Encodes the signal peptide and extracellular domain of human TRAIL R2 (aa 1-182) was fused to the Fc region of human IgG1 (aa 90-330). The chimeric protein was expressed in modified human 293 cells.

Associated products

  • Related Products

    • Anti-DR5 antibody (ab1675)

Specifications

Our Abpromise guarantee covers the use of ab83547 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilized
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.

    Constituents: 1% Human serum albumin, 10% Trehalose

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    It is recommended that 0.5 ml of sterile phosphate-buffered saline be added to the vial. When reconstituted in 0.5 ml sterile phosphate-buffered saline, the solution will contain 1% human serum albumin (HSA) and 10% trehalose.

General Info

  • Alternative names

    • Fas like protein
    • Apoptosis inducing protein TRICK2A/2B
    • Apoptosis inducing receptor TRAIL R2
    • CD262
    • CD262 antigen
    • Cytotoxic TRAIL receptor 2
    • Death domain containing receptor for TRAIL/Apo 2L
    • Death receptor 5
    • DR5
    • KILLER
    • KILLER/DR5
    • OTTHUMP00000123492
    • OTTHUMP00000123493
    • p53 regulated DNA damage inducible cell death receptor(killer)
    • TNF related apoptosis inducing ligand receptor 2
    • TNF-related apoptosis-inducing ligand receptor 2
    • TNFRSF10B
    • TR10B_HUMAN
    • TRAIL R2
    • TRAIL receptor 2
    • TRAIL-R2
    • TRAILR2
    • TRICK2
    • TRICK2A
    • TRICK2B
    • TRICKB
    • Tumor necrosis factor receptor like protein ZTNFR9
    • Tumor necrosis factor receptor superfamily member 10B
    • Tumor necrosis factor receptor superfamily, member 10b
    • ZTNFR9
    see all
  • Function

    Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
  • Tissue specificity

    Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus, placenta, testis, esophagus, stomach and throughout the intestinal tract; not detectable in brain.
  • Involvement in disease

    Squamous cell carcinoma of the head and neck
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Target information above from: UniProt accession O14763 The UniProt Consortium
    The Universal Protein Resource (UniProt) in 2010
    Nucleic Acids Res. 38:D142-D148 (2010) .

    Information by UniProt

Images

  • SDS-PAGE - Recombinant human DR5 protein (Fc Chimera) (ab83547)
    SDS-PAGE - Recombinant human DR5 protein (Fc Chimera) (ab83547)
    Lane 1 – MW markers; Lane 2 – ab83547; Lane 3 – ab83547 treated with PNGase F to remove potential N-linked glycans; Lane 4 – ab83547 treated with a glycosidase cocktail to remove potential N- and O-linked glycans. Approximately 5 μg of protein was loaded per lane; Gel was stained using Coomassie.
    Drop in MW after treatment with PNGase F indicates presence of N-linked glycans. A further drop in MW after treatment with the glycosidase cocktail indicates the presence of O-linked glycans. Additional bands in lane 3 and lane 4 are glycosidase enzymes.
  • SDS-PAGE - Recombinant human DR5 protein (Fc Chimera) (ab83547)
    SDS-PAGE - Recombinant human DR5 protein (Fc Chimera) (ab83547)
    A sample of ab83547 without carrier protein was reduced and alkylated and focused on a 3-10 IPG strip then run on a 4-20% Tris-HCl 2D gel. Approximately 40 μg of protein was loaded; Gel was stained using Deep Purple™. The spot train indicates the presence of multiple isoforms of ab83547. Spots within the spot train were cut from the gel and identified as ab83547 by protein mass fingerprinting.
  • Functional Studies - Recombinant human DR5 protein (Fc Chimera) (ab83547)
    Functional Studies - Recombinant human DR5 protein (Fc Chimera) (ab83547)
    Post-translational modifications result in protein heterogeneity. The densitometry scan demonstrates that ab83547 exists in multiple isoforms, which differ according to their level of post-translational modification. Expression of these isoforms is highly significant for cell biology, as they more closely resemble the native human proteins.
    The triangle indicates theoretical pI and MW of the protein.

Protocols

To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

Click here to view the general protocols

Datasheets and documents

    • Datasheet
  • References (0)

    Publishing research using ab83547? Please let us know so that we can cite the reference in this datasheet.

    ab83547 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a question

    Question

    Based on the descriptions, they are all Fc-fusions of DR5 protein. I'm trying to understand if they have a functional difference, and what the source of that difference may be.

    Read More

    Abcam community

    Verified customer

    Asked on Apr 15 2013

    Answer


    These proteins are all Fc-fusions of different fragments of DR5. Ab83547 contains amino acids 56-182, ab56519 contains amino acids 1-182, and ab109149 contains amino acids 52-212. Because of these different sequences, the functionality may vary among the proteins.
    Ab56519 has not been tested for functionality, but the other two proteins have been shown to neutralize TRAIL activity, and we fully guarantee them to do so.

    Read More

    Abcam Scientific Support

    Answered on Apr 15 2013

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.