Bioactive grade

Recombinant human DR5 protein (Fc Chimera Active) (ab229374)

Description

  • Product name

    Recombinant human DR5 protein (Fc Chimera Active)
    See all DR5 proteins and peptides
  • Biological activity

    Measured by its ability to inhibit cytotoxicity assay using Jurkat human T lymphocyte. The ED50 for this effect less or equal to 5 ng/ml with TRAIL.

  • Purity

    > 90 % SDS-PAGE.
    ab229374 was purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ITQQDLAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYST HWNDLLFCLRCTRCDSGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRK CRTGCPRGMVKVGDCTPWSDIECVHKESGTKHSGEVPAVEETVTSSPGTP ASPCSLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVL HQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELT KNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSK LTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
    • Predicted molecular weight

      44 kDa including tags
    • Amino acids

      56 to 210
    • Tags

      His tag C-Terminus
    • Additional sequence information

      Extracellular domain fused to hIgG-His-tag at C-terminus.

Specifications

Our Abpromise guarantee covers the use of ab229374 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: PBS, 10% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Fas like protein
    • Apoptosis inducing protein TRICK2A/2B
    • Apoptosis inducing receptor TRAIL R2
    • CD262
    • CD262 antigen
    • Cytotoxic TRAIL receptor 2
    • Death domain containing receptor for TRAIL/Apo 2L
    • Death receptor 5
    • DR5
    • KILLER
    • KILLER/DR5
    • OTTHUMP00000123492
    • OTTHUMP00000123493
    • p53 regulated DNA damage inducible cell death receptor(killer)
    • TNF related apoptosis inducing ligand receptor 2
    • TNF-related apoptosis-inducing ligand receptor 2
    • TNFRSF10B
    • TR10B_HUMAN
    • TRAIL R2
    • TRAIL receptor 2
    • TRAIL-R2
    • TRAILR2
    • TRICK2
    • TRICK2A
    • TRICK2B
    • TRICKB
    • Tumor necrosis factor receptor like protein ZTNFR9
    • Tumor necrosis factor receptor superfamily member 10B
    • Tumor necrosis factor receptor superfamily, member 10b
    • ZTNFR9
    see all
  • Function

    Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
  • Tissue specificity

    Widely expressed in adult and fetal tissues; very highly expressed in tumor cell lines such as HeLaS3, K-562, HL-60, SW480, A-549 and G-361; highly expressed in heart, peripheral blood lymphocytes, liver, pancreas, spleen, thymus, prostate, ovary, uterus, placenta, testis, esophagus, stomach and throughout the intestinal tract; not detectable in brain.
  • Involvement in disease

    Squamous cell carcinoma of the head and neck
  • Sequence similarities

    Contains 1 death domain.
    Contains 3 TNFR-Cys repeats.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab229374.

    MW 40-57 kDa (SDS-PAGE under reducing conditions).

References

ab229374 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab229374.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up