Description

  • Product name

    Recombinant Human DRAK2 protein
  • Purity

    > 90 % SDS-PAGE.
    ab139233 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMSRRRFDCRSISGLLTTTPQIPIKMEN FNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRAEI LHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELA EMVSENDVIRLIKQILEGVYYLHQNNIVHLDLKPQNILLSSIYPLGDIKI VDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIAYM LLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKN PEKRPTAEICLSHSWLQQWDFENLFHPEETSSSSQTQDHSVRSSEDKTSK SSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLLC
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      1 to 372
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab139233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.03% DTT, 0.32% Tris HCl, 10% Glycerol, 0.58% Sodium chloride

General Info

  • Alternative names

    • DAP kinase related apoptosis inducing protein
    • DAP kinase related apoptosis inducing protein kinase 2
    • DAP kinase-related apoptosis-inducing protein kinase 2
    • Death associated protein kinase related 2
    • DRAK 2
    • DRAK2
    • Serine/threonine kinase 17b
    • Serine/threonine kinase 17b apoptosis inducing
    • Serine/threonine protein kinase 17B
    • Serine/threonine-protein kinase 17B
    • ST17B_HUMAN
    • STK 17B
    • Stk17b
    see all
  • Function

    Acts as a positive regulator of apoptosis.
  • Tissue specificity

    Highly expressed in placenta, lung, pancreas. Lower levels in heart, brain, liver, skeletal muscle and kidney.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. DAP kinase subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab139233.

References

ab139233 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab139233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up