Description

  • Product name

    Recombinant Human DREF protein
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      NKSLESSQTDLKLVAHPRAKSKVWKYFGFDTNAEGCILQWKKIYCRICMA QIAYSGNTSNLSYHLEKNHPEEFCEFVKSNTEQMREAFATAFSKLKPE
    • Predicted molecular weight

      11 kDa
    • Amino acids

      3 to 100
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152028 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

    Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Please see notes section.

    pH: 7.20
    Constituents: 99% Phosphate Buffer, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.

General Info

  • Alternative names

    • Ac like transposable element
    • ALTE
    • BED type zinc finger domain containing protein 1
    • DNA replication related element binding factor
    • dREF homolog
    • hDREF
    • KIAA0785
    • Putative Ac like transposon
    • Putative Ac-like transposable element
    • TRAMP
    • ZBED1
    • ZBED1_HUMAN
    • Zinc finger BED domain-containing protein 1
    • Zinc finger BED type containing 1
    see all
  • Function

    Binds to 5'-TGTCG[CT]GA[CT]A-3' DNA elements found in the promoter regions of a number of genes related to cell proliferation. Binds to the histone H1 promoter and stimulates transcription. Was first identified as gene weakly similar to Ac transposable elements, but does not code for any transposase activity.
  • Tissue specificity

    Ubiquitously expressed at low levels. Expression is highest in skeletal muscle, heart, spleen and placenta.
  • Sequence similarities

    Contains 1 BED-type zinc finger.
  • Cellular localization

    Nucleus. In granular structures.
  • Information by UniProt

References

ab152028 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152028.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up