Description

  • Product name

    Recombinant Human DRG1 protein
  • Purity

    > 85 % SDS-PAGE.
    ab109940 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSSTLAKIAEIEAEMARTQKNKATAHHLGL LKARLAKLRRELITPKGGGGGGPGEGFDVAKTGDARIGFVGFPSVGKSTL LSNLAGVYSEVAAYEFTTLTTVPGVIRYKGAKIQLLDLPGIIEGAKDGKG RGRQVIAVARTCNLILIVLDVLKPLGHKKIIENELEGFGIRLNSKPPNIG FKKKDKGGINLTATCPQSELDAETVKSILAEYKIHNADVTLRSDATADDL IDVVEGNRVYIPCIYVLNKIDQISIEELDIIYKVPHCVPISAHHRWNFDD LLEKIWDYLKLVRIYTKPKGQLPDYTSPVVLPYSRTTVEDFCMKIHKNLI KEFKYALVWGLSVKHNPQKVGKDHTLEDEDVIQIVKK
    • Predicted molecular weight

      43 kDa including tags
    • Amino acids

      1 to 367
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab109940 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 0.0292% EDTA, 30% Glycerol

General Info

  • Alternative names

    • Developmentally regulated GTP binding protein 1
    • Developmentally-regulated GTP-binding protein 1
    • DKFZp434N1827
    • DRG 1
    • DRG-1
    • DRG1
    • DRG1_HUMAN
    • NEDD 3
    • NEDD-3
    • NEDD3
    • Neural precursor cell expressed developmentally down regulated protein 3
    • Neural precursor cell expressed developmentally down-regulated protein 3
    see all
  • Function

    May play a role in cell proliferation, differentiation and death.
  • Tissue specificity

    High levels in skeletal muscle, heart, and kidney. Intermediate levels in liver, placenta and brain. Low levels in colon, thymus, spleen, small intestine, lung and leukocytes.
  • Sequence similarities

    Belongs to the GTP1/OBG family.
    Contains 1 G (guanine nucleotide-binding) domain.
  • Domain

    Its C-terminal domain interacts with TAL1.
  • Post-translational
    modifications

    Polyubiquitinated; which induces proteolytic degradation and is impaired by interaction with ZC3H15.
    Sumoylated by UBE2I in response to MEKK1-mediated stimuli.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab109940.

References

ab109940 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab109940.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up