Overview

  • Product name

    Recombinant Human DRP1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MEALIPVINKLQDVFNTVGADIIQLPQIVVVGTQSSGKSSVLESLVGRDL LPRGTGIVTRRPLILQLVHVSQEDKRKTTGEENGVEAEEWGKFLHTKNKL YTDFDEIRQEIENETERISGNNKGVSPEPIHLKIFSPNVVNLTLVDLPGM TKVPVGDQPKDIELQIRELILRFISNPNSIILAVTAANTDMATSEALKIS REVDPDGRRTLAVITKLDLMDAGTDAMDVLMGRVIPVKLGIIGVVNRSQL DINNKKSVTDSIRDEYAFLQKKYPSLANRNGTKYLARTLNRLLMHHIRDC LPELKTRINVLAAQYQSLLNSYGEPVDDKSATLLQLITKFATEYCNTIEG TAKYIETSELCGGARICYIFHETFGRTLESVDPLGGLNTIDILTAIRNAT GPRPALFVPEVSFELLVKRQIKRLEEPSLRCVELVHEEMQRIIQHCSNYS TQELLRFPKLHDAIVEVVTCLLRKRLPVTNEMVHNLVAIELAYINTKHPD FADACGLMNNNIEEQRRNRLARELPSAVSRDKLIQDSRRETKNVASGGGG VGDGVQEPTTGNWRGMLKTSKAEELLAEEKSKPIPIMPASPQKGHAVNLL DVPVPVARKLSAREQRDCEVIERLIKSYFLIVRKNIQDSVPKAVMHFLVN HVKDTLQSELVGQLYKSSLLDDLLTESEDMAQRRKEAADMLKALQGASQI IAEIRETHLW
    • Amino acids

      1 to 710
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153041 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • DLP1
    • dnm1l
    • DNM1L_HUMAN
    • Dnm1p/Vps1p-like protein
    • dnml1
    • DRP1
    • DVLP
    • Dymple
    • Dynamin 1 like
    • Dynamin family member proline-rich carboxyl-terminal domain less
    • Dynamin like protein
    • Dynamin related protein 1
    • Dynamin-1-like protein
    • Dynamin-like protein
    • Dynamin-like protein 4
    • Dynamin-like protein IV
    • Dynamin-related protein 1
    • DYNIV 11
    • EMPF
    • EMPF1
    • FLJ41912
    • HdynIV
    • VPS1
    see all
  • Function

    Functions in mitochondrial and peroxisomal division. Mediates membrane fission through oligomerization into ring-like structures which wrap around the scission site to constict and sever the mitochondrial membrane through a GTP hydrolysis-dependent mechanism. Required for normal brain development. Facilitates developmentally-regulated apoptosis during neural tube development. Required for a normal rate of cytochrome c release and caspase activation during apoptosis. Also required for mitochondrial fission during mitosis. May be involved in vesicle transport.
    Isoform 1 and isoform 4 inhibit peroxisomal division when overexpressed.
  • Tissue specificity

    Ubiquitously expressed with highest levels found in skeletal muscles, heart, kidney and brain. Isoform 1 is brain-specific. Isoform 2 and isoform 3 are predominantly expressed in testis and skeletal muscles respectively. Isoform 4 is weakly expressed in brain, heart and kidney. Isoform 5 is dominantly expressed in liver, heart and kidney. Isoform 6 is expressed in neurons.
  • Involvement in disease

    Note=May be associated with Alzheimer disease through beta-amyloid-induced increased S-nitrosylation of DNM1L, which triggers, directly or indirectly, excessive mitochondrial fission, synaptic loss and neuronal damage.
  • Sequence similarities

    Belongs to the dynamin family.
    Contains 1 GED domain.
  • Domain

    The GED domain folds back to interact, in cis, with the GTP-binding domain and middle domain, and interacts, in trans, with the GED domains of other DNM1L molecules, and is thus critical for activating GTPase activity and for DNM1L dimerization.
  • Post-translational
    modifications

    Phosphorylation/dephosphorylation events on two sites near the GED domain regulate mitochondrial fission. Phosphorylation on Ser-637 inhibits mitochondrial fissin probably through preventing intramolecular interaction. Dephosphorylated on this site by PPP3CA which promotes mitochondrial fission. Phosphorylation on Ser-616 also promotes mitochondrial fission.
    Sumoylated on various lysine residues within the B domain. Desumoylated by SENP5 during G2/M transition of mitosis. Appears to be linked to its catalytic activity.
    S-nitrosylation increases DNM1L dimerization, mitochondrial fission and causes neuronal damage.
    Ubiquitination by MARCH5 affects mitochondrial morphology.
  • Cellular localization

    Cytoplasm > cytosol. Golgi apparatus. Endomembrane system. Mainly cytosolic. Translocated to the mitochondrial membrane through interaction with FIS1. Colocalized with MARCH5 at mitochondrial membrane. Localizes to mitochondria at sites of division. Associated with peroxisomal membranes, partly recruited there by PEX11B. May also be associated with endoplasmic reticulum tubules and cytoplasmic vesicles and found to be perinuclear. In some cell types, localizes to the Golgi complex.
  • Information by UniProt

Images

  • ab153041 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153041 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153041.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up