Recombinant Human DSCAML1 protein (ab163552)
Key features and details
- Expression system: Wheat germ
- Tags: GST tag N-Terminus
- Suitable for: ELISA, WB
Description
-
Product name
Recombinant Human DSCAML1 protein -
Expression system
Wheat germ -
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
SEPGICRFTASPPKPQDADRGKNVAVPIPHRANKSDYCNLPLYAKSEAFF RKADGREPCPVVPPREASIRNLARTYHTQARHLTLDP -
Amino acids
1922 to 2008 -
Tags
GST tag N-Terminus
-
Specifications
Our Abpromise guarantee covers the use of ab163552 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
ELISA
Western blot
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- Down syndrome cell adhesion molecule 2
- Down syndrome cell adhesion molecule like 1
- Down syndrome cell adhesion molecule like protein 1
see all -
Function
Cell adhesion molecule that plays a role in neuronal self-avoidance. Promotes repulsion between specific neuronal processes of either the same cell or the same subtype of cells. Promotes both isoneuronal self-avoidance for creating an orderly neurite arborization in retinal rod bipolar cells and heteroneuronal self-avoidance to maintain mosaic spacing between AII amacrine cells. -
Tissue specificity
Detected in heart, liver, pancreas, skeletal muscle, kidney and in brain, in particular in the amygdala, caudate nucleus, corpus callosum, hippocampus, substantia nigra, thalamus and subthalamus. -
Sequence similarities
Contains 6 fibronectin type-III domains.
Contains 10 Ig-like C2-type (immunoglobulin-like) domains. -
Cellular localization
Cell membrane. - Information by UniProt
Images
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab163552 has not yet been referenced specifically in any publications.