Description

  • Product name

    Recombinant Human DSN1 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MTSVTRSEIIDEKGPVMSKTHDHQLESSLSPVEVFAKTSASLEMNQGVSE ERIHLGSSPKKGGNCDLSHQERLQSKSLHLSPQEQSASYQDRRQSWRRAS MKETNRRKSLHPIHQGITELSRSISVDLAESKRLGCLLLSSFQFSIQKLE PFLRDTKGFSLESFRAKASSLSEELKHFADGLETDGTLQKCFEDSNGKAS DFSLEASVAEMKEYITKFSLERQTWDQLLLHYQQEAKEILSRGSTEAKIT EVKVEPMTYLGSSQNEVLNTKPDYQKILQNQSKVFDCMELVMDELQGSVK QLQAFMDESTQCFQKVSVQLGKRSMQQLDPSPARKLLKLQLQNPPAIHGS GSGSCQ
    • Amino acids

      1 to 356
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164171 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • C20orf172
    • Chromosome 20 open reading frame 172
    • dJ469A13.2
    • DSN1
    • DSN1, MIND kinetochore complex component, homolog
    • DSN1, MIND kinetochore complex component, homolog (S. cerevisiae)
    • DSN1, MIS12 kinetochore complex component
    • DSN1_HUMAN
    • FLJ13346
    • hKNL-3
    • Kinetochore associated protein DSN1
    • Kinetochore associated protein DSN1 homolog
    • Kinetochore null 3 homolog
    • Kinetochore-associated protein DSN1 homolog
    • KNL3
    • MGC32987
    • MIS13
    see all
  • Function

    Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis.
  • Cellular localization

    Nucleus. Chromosome > centromere > kinetochore. Associated with the kinetochore.
  • Information by UniProt

Images

  • ab164171 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164171 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164171.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up