Description

  • Product name

    Recombinant Human DSU protein (His tag)
  • Purity

    > 90 % SDS-PAGE.
    ab177607 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMGLRDWLRTVCCCCGCECLEERALPEK EPLVSDNNPYSSFGATLVRDDEKNLWSMPHDVSHTEADDDRTLYNLIVIR NQQAKDSEEWQKLNYDIHTLRQVRREVRNRWKCILEDLGFQKEADSLLSV TKLSTISDSKNTRKAREMLLKLAEETNIFPTSWELSERYLFVVDRLIALD AAEEFFKLARRTYPKKPGVPCLADGQKELHYLPFPSP
    • Predicted molecular weight

      27 kDa including tags
    • Amino acids

      1 to 214
    • Tags

      His tag N-Terminus
    • Additional sequence information

      (NP_060470)

Specifications

Our Abpromise guarantee covers the use of ab177607 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 0.88% Sodium chloride, 10% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • Dilute suppressor
    • Dilute suppressor protein homolog
    • DSU
    • FLJ10116
    • Melanoregulin
    • MGC90296
    • MREG
    • OTTHUMP00000206794
    • OTTHUMP00000206795
    • OTTHUMP00000206796
    • WDT 2
    • WDT2
    • Whn dependent transcript 2
    see all
  • Relevance

    DSU (Dilute suppressor) is also known as Melanoregulin. It has a role in the incorporation of pigments into hair. It is involved in organelle biogenesis and may function in membrane fusion. It may also regulate the biogenesis of disk membranes, specialized organelles of photoreceptor rod cells.
  • Cellular localization

    Apical cell membrane; Peripheral membrane protein. Note: Localizes to the inner segment and basal outer segment of rods in the retina.

Images

  • 15% SDS-PAGE analysis of ab177607 (3 µg).

References

ab177607 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177607.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up