Overview

  • Product name
    Recombinant Human DTN-A protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNL HLVDIWNVIEALRENALNNLDPNTELNVSRLEAVLSTIFYQLNKRMPTTH QIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLCGGKIMDKLRY IFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQ QKKVTLNGFLDTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSES MMGFRYRCQQCHNYQLCQDCFWRGHAGGSHSNQHQMKEYTSWKSPAKKLT NALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVPPRPVTSMNDTLFSHS VPSSGSPFITRSSDGAFGGCV
    • Amino acids
      1 to 371
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158323 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Alpha-dystrobrevin
    • D18S892E
    • DRP3
    • DTN
    • DTN-A
    • DTNA
    • DTNA_HUMAN
    • Dystrobrevin alpha
    • Dystrophin related protein 3
    • Dystrophin-related protein 3
    • FLJ96209
    • LVNC1
    • OTTHUMP00000163151
    • OTTHUMP00000163152
    • OTTHUMP00000163153
    • OTTHUMP00000163154
    • OTTHUMP00000163155
    see all
  • Function
    May be involved in the formation and stability of synapses as well as being involved in the clustering of nicotinic acetylcholine receptors.
  • Tissue specificity
    Highly expressed in brain, skeletal and cardiac muscles, and expressed at lower levels in lung, liver and pancreas. Isoform 2 is not expressed in cardiac muscle. Isoform 7 and isoform 8 are only expressed in muscle.
  • Involvement in disease
    Defects in DTNA are the cause of left ventricular non-compaction type 1 (LVNC1) [MIM:604169]. Left ventricular non-compaction is due to an arrest of myocardial morphogenesis. The disorder is characterized by a hypertrophic left ventricule with deep trabeculations and with poor systolic function, with or without associated left ventricular dilation. In some cases, it is associated with other congenital heart anomalies such as ventricular septal defects, pulmonic stenosis and atrial septal defects. The right ventricle may also be affected.
  • Sequence similarities
    Belongs to the dystrophin family. Dystrobrevin subfamily.
    Contains 1 ZZ-type zinc finger.
  • Domain
    The coiled coil domain mediates the interaction with dystrophin and utrophin.
  • Post-translational
    modifications
    Phosphorylation of DTN-1 on tyrosine kinase substrate domain present in the C-terminus.
  • Cellular localization
    Cytoplasm. Cell junction > synapse. Cell membrane. In peripheral nerves, co-localizes with MAGEE1 in the Schwann cell membrane.
  • Information by UniProt

Images

  • ab158323 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158323 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158323.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up