Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MIEESGNKRKTMAEKRQLFIEMRAQNFDVIRLSTYRTACKLRFVQKRCNL HLVDIWNMIEAFRDNGLNTLDHTTEISVSRLETVISSIY
    • Amino acids
      1 to 89
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158325 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Dystrobrevin beta. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Beta dystrobrevin
    • Beta-dystrobrevin
    • DTN B
    • DTN-B
    • Dtnb
    • DTNB_HUMAN
    • Dystrobrevin beta
    • MGC17163
    • MGC57126
    see all
  • Tissue specificity
    Highly expressed in brain, kidney and pancreas.
  • Sequence similarities
    Belongs to the dystrophin family. Dystrobrevin subfamily.
    Contains 1 ZZ-type zinc finger.
  • Domain
    The coiled coil domain may mediate the interaction with dystrophin.
  • Cellular localization
    Cytoplasm.
  • Information by UniProt

Images

  • ab158325 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158325 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158325.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up