Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSRPGHGGLMPVNGLGFPPQNVARVVVWEWLNEHSRWRPYTATVCHHIEN VLKEDARGSVVLGQVDAQLVPYIIDLQSMHQFRQDTGTMRPVRRNFYDPS SAPGKGIVWEWENDGGAWTAYDMDICITIQNAYEKQHPWLDLSSLGFCYL IYFNSMSQMNRQTRRRRRLRRRLDLAYPLTVGSIPKSQSWPVGASSGQPC SCQQCLLVNSTRAASNAILASQRRKAPPAPPLPPPPPPGGPPGALAVRPS ATFTGAALWAAPAAGPAEPAPPPGAPPRSPGAPGGARTPGQNNLNRPGPQ RTTSVSARASIPPGVPALPVKNLNGTGPVHPALAGMTGILLCAAGLPVCL TRAPKPILHPPPVSKSDVKPVPGVPGVCRKTKKKHLKKSKNPEDVVRRYM QKVKNPPDEDCTICMERLVTASGYEGVLRHKGVRPELVGRLGRCGHMYHL LCLVAMYSNGNKDGSLQCPTCKAIYGEKTGTQPPGKMEFHLIPHSLPGFP DTQTIRIVYDIPTGIQGPEHPNPGKKFTARGFPRHCYLPNNEKGRKVLRL LITAWERRLIFTIGTSNTTGESDTVVWNEIHHKTEFGSNLTGHGYPDASY LDNVLAELTAQGVSEAAAKA
    • Amino acids

      1 to 620
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158326 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as Deltex.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Deltex
    • Deltex 1, E3 ubiquitin ligase
    • Deltex homolog 1
    • Deltex homolog 1 (Drosophila)
    • Deltex protein 1
    • Deltex-1
    • Deltex1
    • dtx1
    • DTX1_HUMAN
    • E3 ubiquitin protein ligase DTX1
    • E3 ubiquitin-protein ligase DTX1
    • FXI-T1
    • Fxit 1
    • Fxit1
    • hDTX1
    • hDx 1
    • mDTX1
    • Protein deltex 1
    • Protein deltex-1
    see all
  • Function

    Functions as a ubiquitin ligase protein in vivo, mediating ubiquitination and promoting degradation of MEKK1, suggesting that it may regulate the Notch pathway via some ubiquitin ligase activity (By similarity). Regulator of Notch signaling, a signaling pathway involved in cell-cell communications that regulates a broad spectrum of cell-fate determinations. Mainly acts as a positive regulator of Notch, but it also acts as a negative regulator, depending on the developmental and cell context. Mediates the antineural activity of Notch, possibly by inhibiting the transcriptional activation mediated by MATCH1. Involved in neurogenesis, lymphogenesis and myogenesis, and may also be involved in MZB (Marginal zone B) cell differentiation. Promotes B-cell development at the expense of T-cell development, suggesting that it can antagonize NOTCH1.
  • Tissue specificity

    Widely expressed. Strongly expressed in blood vessel. Also expressed in embryonic nervous system, pancreas, lung, adrenal gland, digestive tube and muscles. Expressed in MZB cells and developing B- and T-cells.
  • Pathway

    Protein modification; protein ubiquitination.
  • Sequence similarities

    Belongs to the Deltex family.
    Contains 1 RING-type zinc finger.
    Contains 2 WWE domains.
  • Domain

    The WWE domains are thought to mediate some protein-protein interaction, and are frequently found in ubiquitin ligases.
  • Post-translational
    modifications

    Ubiquitinated; undergoes 'Lys-29'-linked polyubiquitination catalyzed by ITCH.
  • Cellular localization

    Cytoplasm. Nucleus. Predominantly cytoplasmic. Associates with endocytic vesicles. Partially nuclear.
  • Information by UniProt

Images

  • ab158326 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158326 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158326.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up