Overview

  • Product name
    Recombinant Human DUBA protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MTILPKKKPPPPDADPGGTGVGGGDRDRDSGVVGARPRASPPPQGPLPGP PGALHRWALAVPPGAVAGPRPQQASPPPCGGPGGPGGGPGDALGAAAAGV GAAGVVVGVGGAVGVGGCCSGPGHSKRRRQAPGVGAVGGGSPEREEVGAG YNSEDEYEAAAARIEAMDPATVEQQEHWFEKALRDKKGFIIKQMKEDGAC LFRAVADQVYGDQDMHEVVRKHCMDYLMKNADYFSNYVTEDFTTYINRKR KNNCHGNHIEMQAMAEMYNRPVEVYQYSTEPINTFHGIHQNEDEPIRVSY HRNIHYNSVVNPNKATIGVGLGLPSFKPGFAEQSLMKNAIKTSEESWIEQ QMLEDKKRATDWEATNEAIEEQVARESYLQWLRDQEKQARQVRGPSQPRK ASATCSSATAAASSGLEEWTSRSPRQRSSASSPEHPELHAELGMKPPSPG TVLALAKPPSPCAPGTSSQFSAGADRATSPLVSLYPALECRALIQQMSPS AFGLNDWDDDEILASVLAVSQQEYLDSMKKNKVHRDPPPDKS
    • Amino acids
      1 to 542
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163135 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Protein previously labeled as OTUD5.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Deubiquinating enzyme A
    • Deubiquitinating enzyme A
    • DKFZp761A052
    • DUBA
    • MGC104871
    • OTTHUMP00000025821
    • OTU domain containing 5
    • OTU domain containing protein 5
    • OTU domain-containing protein 5
    • OTUD 5
    • otud5
    • OTUD5_HUMAN
    see all
  • Function
    Negative regulator of innate immune system. Has deubiquitinating activity that is directed towards 'Lys-63'-linked polyubiquitin chains. Acts via TRAF3 deubiquitination and subsequent suppression of type I interferon (IFN) production.
  • Tissue specificity
    Expressed in various tissues, including the liver and placenta, as well as in peripheral blood leukocytes.
  • Sequence similarities
    Belongs to the peptidase C85 family.
    Contains 1 OTU domain.
  • Information by UniProt

Images

  • ab163135 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163135 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163135.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up