Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MLEAPGPSDGCELSNPSASRVSCAGQMLEVQPGLYFGGAAAVAEPDHLRE AGITAVLTVDSEEPSFKAGPGVEDLWRLFVPALDKPETDLLSHLDRCVAF IGQARAEGRAVLVHCHAGVSRSVAIITAFLMKTDQLPFEKAYEKLQILKP EAKMNEGFEWQLKLYQAMGYEVDTSSAIYKQYRLQKVTEKYPELQNLPQE LFAVDPTTVSQGLKDEVLYKCRKCRRSLFRSSSILDHREGSGPIAFAHKR MTPSSMLTTGRQAQCTSYFIEPVQWMESALLGVMDGQLLCPKCSAKLGSF NWYGEQCSCGRWITPAFQIHKNRVDEMKILPVLGSQTGKI
    • Molecular weight

      63 kDa including tags
    • Amino acids

      1 to 340

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132330 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Dual specificity phosphatase 12
    • Dual specificity protein phosphatase 12
    • Dual specificity tyrosine phosphatase YVH1
    • DUS12_HUMAN
    • DUSP 1
    • DUSP 12
    • DUSP1
    • DUSP12
    • Serine/threonine specific protein phosphatase
    • TDSP4
    • YVH 1
    • YVH1
    • YVH1 protein tyrosine phosphatase (S. cerevisiae) ortholog
    • YVH1 protein tyrosine phosphatase ortholog
    see all
  • Tissue specificity

    Ubiquitous, highest expression in spleen, testis, ovary, and peripheral blood leukocytes and lower expression in liver and lung.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132330 stained with Coomassie Blue.

References

ab132330 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Question
Answer

Thank you for contacting us. The activity for ab 113160 is as follows:

Specific activity: >1,750 units/mg. Enzymatic activity was confirmed by measuring the amount of enzyme hydrolyzing 1 nmole of p-nitrophenyl phosphate (pNPP) per minute at 37C, pH7.5 using 10mM of substrate

The activity of all the other proteins has not yet been tested. As a rule it should say "active" in the titale if it is active, however when new testing occurs it is not always immediately put into the title, so if there are ever any proteins you interested in we can always check them for you since once in a while you find one that has been tested but not updated. We currently have a project in the works that will update this active status more immediately.

I hope this information is helpful to you. Please do not hesitate to contact us if you need any more advice or information.

Use our products? Submit an Abreview. Earn rewards!
https://www.abcam.com/abreviews

Read More

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up