Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MYSLNQEIKAFSRNNLRKQCTRVTTLTGKKIIETWKDARIHVVEEVEPSS GCGCGYVQDLSSDLQVGVIKPWLLLGSQDAAHDLDTLKKNKVTHILNVAY GVENAFLSDFTYKSISILDLPETNILSYFPECFEFIEEAKRKDGVVLVHC NAGVSRAAAIVIGFLMNSEQTSFTSAFSLVKNARPSICPNSGFMEQLRTY QEGKESDKCDRIQENSS
    • Amino acids
      1 to 217
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab165490 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Dual specificity phosphatase 19
    • Dual specificity phosphatase TS DSP1
    • Dual specificity phosphatase TS-DSP1
    • Dual specificity protein phosphatase 19
    • DUS19_HUMAN
    • DUSP 17
    • DUSP 19
    • DUSP17
    • Dusp19
    • LMW DSP3
    • LMW-DSP3
    • LMWDSP 3
    • LMWDSP3
    • Low molecular weight dual specificity phosphatase 3
    • MGC138210
    • Protein phosphatase SKRP1
    • SAPK pathway regulating phosphatase 1
    • SAPK pathway-regulating phosphatase 1
    • SKRP 1
    • SKRP1
    • Stress activated protein kinase pathway regulating phosphatase 1
    • Stress-activated protein kinase pathway-regulating phosphatase 1
    • TS DSP1
    see all
  • Function
    Has a dual specificity toward Ser/Thr and Tyr-containing proteins.
  • Tissue specificity
    Expressed in the heart, lung, liver, and pancreas. The expression level in the pancreas is the highest.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 tyrosine-protein phosphatase domain.
  • Information by UniProt

Images

  • ab165490 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab165490 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab165490.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up