Overview

  • Product name

    Recombinant Human DUSP7 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MLRRLRKGNLPIRSIIPNHADKERFATRCKAATVLLYDEATAEWQPEPGA PASVLGLLLQKLRDDGCQAYYLQGGFNKFQTEYSEHCETNVDSSSSPSSS PPTSVLGLGGLRISSDCSDGESDRELPSSATESDGSPVPSSQPAFPVQIL PYLYLGCAKDSTNLDVLGKYGIKYILNVTPNLPNAFEHGGEFTYKQIPIS DHWSQNLSQFFPEAISFIDEARSKKCGVLVHCLAGISRSVTVTVAYLMQK MNLSLNDAYDFVKRKKSNISPNFNFMGQLLDFERTLGLSSPCDNHASSEQ LYFSTPTNHNLFPLNTLEST
    • Amino acids

      1 to 320
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158328 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Dual specificity phosphatase 7
    • Dual specificity protein phosphatase 7
    • Dual specificity protein phosphatase PYST2
    • DUS7_HUMAN
    • Dusp7
    • Jnk Stimulatory Phosphatase 1
    • JSP1
    • MAP kinase phosphatase X
    • MKPX
    • PYST2
    see all
  • Function

    Regulates the activity of the MAP kinase family in response to changes in the cellular environment. PYST2-S may act as a negative regulator of PYST2-L although it is unclear whether this is by competing for transcription, translation or activation factors.
  • Tissue specificity

    Expressed at significantly higher levels in malignant hematopoietic cells than in corresponding non-malignant cells.
  • Sequence similarities

    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 rhodanese domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization

    Cytoplasm.
  • Information by UniProt

Images

  • ab158328 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158328 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158328.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up