Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      AGDRLPRKVMDAKKLASLLRGGPGGPLVIDSRSFVEYNSWHVLSSVNICC SKLVKRRLQQGKVTIAELIQPAARSQVEATEPQDVVVYDQSTRDASVLAA DSFLSILL
    • Amino acids
      2 to 109
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • C11orf81
    • Chromosome 11 open reading frame 81
    • Deubiquitinating enzyme 8
    • Dual Specificity Phosphatase 8
    • Dual specificity phosphatase M3/6
    • Dual specificity protein phosphatase 8
    • Dual specificity protein phosphatase hVH 5
    • Dual specificity protein phosphatase hVH-5
    • DUS8
    • DUS8_HUMAN
    • DUSP8
    • EC 3.1.3.16
    • EC 3.1.3.48
    • FLJ42476
    • FLJ42958
    • H1 phosphatase vaccinia virus homolog
    • H1 phosphatase, vaccinia virus, homolog of
    • HB5
    • hUBPy
    • HVH5
    • HVH8
    • M3/6, mouse, homolog of
    • Neuronal tyrosine threonine phosphatase 1
    • Serine/threonine specific protein phosphatase
    • Ubiquitin carboxyl terminal hydrolase 8
    • Ubiquitin specific processing protease 8
    • Ubiquitin thiolesterase 8
    • VH5
    see all
  • Function
    This protein shows both activity toward tyrosine-protein phosphate as well as with serine/threonine-protein phosphate.
  • Tissue specificity
    Abundant in brain, heart and skeletal muscle.
  • Sequence similarities
    Belongs to the protein-tyrosine phosphatase family. Non-receptor class dual specificity subfamily.
    Contains 1 rhodanese domain.
    Contains 1 tyrosine-protein phosphatase domain.
  • Cellular localization
    Cytoplasm. Nucleus.
  • Information by UniProt

Images

  • ab158329 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up