Description

  • Product name

    Recombinant Human dUTPase protein (BSA and azide free)
    See all dUTPase proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MPCSEETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDL YSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGV IDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDD TERGSGGFGSTGKN
    • Predicted molecular weight

      26 kDa
    • Amino acids

      1 to 164

Specifications

Our Abpromise guarantee covers the use of ab173062 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    Supplied as a 0.2 µM filtered solution.

General Info

  • Alternative names

    • Deoxyuridine 5' triphosphate nucleotidohydrolase, nuclear isoform
    • Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial
    • Deoxyuridine triphosphatase
    • dut
    • DUT_HUMAN
    • dUTP nucleotidohydrolase
    • dUTP pyrophosphatase
    • dUTPase
    • FLJ20622
    see all
  • Function

    This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.
  • Tissue specificity

    Found in a variety of tissues.
  • Pathway

    Pyrimidine metabolism; dUMP biosynthesis; dUMP from dCTP (dUTP route): step 2/2.
  • Sequence similarities

    Belongs to the dUTPase family.
  • Post-translational
    modifications

    Phosphorylation in mature T-cells occur in a cell cycle-dependent manner.
  • Cellular localization

    Mitochondrion and Nucleus.
  • Information by UniProt

References

ab173062 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab173062.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up