Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MALLTALDDTLPEEAQGPGRRMILLSTPSQSDALRACFERNLYPGIATKE QLAQGIDIPEPRVQIWFQNERSCQLRQHRRQSRPWPGRRDPQKGRRKRTA ITGSQTALLLRAFEKDRFPGIPAREELARETGLPESRIQLWFQNRRARHW GQSGRAPTQASIRCNAAPIG
    • Amino acids

      1 to 170
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • double homeobox 3
    • Putative double homeobox protein 3
  • Relevance

    DUX3 belongs to the paired homeobox family and contains 2 homeobox DNA-binding domains. It expressed in hepatoma Hep3B cells. DUX genes are present in 3.3-kilobase elements, a tandem repeat family scattered in the genome found on the short arms of all acrocentric chromosomes as well as on several other chromosomes. May be functional despite lack of introns and of a poly(A) addition signal. Two different isoforms are known.
  • Cellular localization

    Nuclear

Images

  • ab162021 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up