Overview

  • Product name

    Recombinant Human Dynamin 2 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGNRGMEELIPLVNKLQDAFSSIGQSCHLDLPQIAVVGGQSAGKSSVLEN FVGRDFLPRGSGIVTRRPLILQLIFSKTEHAEFLHCKSKKFTDFDEVRQE IEAETDRVTGTNKGISPVPINLRVYSPHVLNLTLIDLPGITKVPVGDQPP DIEYQIKDMILQFISRESSLILAVTPANMDLANSDALKLAKEVDPQGLRT IGVITKLDLMDEGTDARDVLENKLLPLRRGYIGVVNRSQKDIEGKKDIRA ALAAERKFFLSHPAYRHMADRMGTPHLQKTLNQQLTNHIRESLPALRSKL QSQLLSLEKEVEEYKNFRPDDPTRKTKALLQMVQQFGVDFEKRIEGSGDQ VDTLELSGGARINRIFHERFPFELVKMEFDEKDLRREISYAIKNIHGVRT GLFTPDLAFEAIVKKQVVKLKEPCLKCVDLVIQELINTVRQCTSKLSSYP RLREETERIVTTYIREREGRTKDQILLLIDIEQSYINTNHEDFIGFANAQ QRSTQLNKKRAIPNQGEILVIRRGWLTINNISLMKGGSKEYWFVLTAESL SWYKDEEEKEKKYMLPLDNLKIRDVEKGFMSNKHVFAIFNTEQRNVYKDL RQIELACDSQEDVDSWKASFLRAGVYPEKDQAENEDGAQENTFSMDPQLE RQVETIRNLVDSYVAIINKSIRDLMPKTIMHLMINNTKAFIHHELLAYLY SSADQSSLMEESADQAQRRDDMLRMYHALKEALNIIGDISTSTVSTPVPP PVDDTWLQSASSHSPTPQRRPVSSIHPPGRPPAVRGPTPGPPLIPVPVGA AASFSAPPIPSRPGPQSVFANSDLFPAPPQIPSRPVRIPPGIPPGVPSRR PPAAPSRPTIIRPAEPSLLD
    • Molecular weight

      125 kDa including tags
    • Amino acids

      1 to 870

Specifications

Our Abpromise guarantee covers the use of ab132947 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CMT2M
    • CMTDI1
    • CMTDIB
    • DI CMTB
    • Dnm2
    • DYN II
    • DYN2
    • DYN2_HUMAN
    • Dynamin II
    • Dynamin-2
    • Dynamin2
    • DynaminII
    • DYNII
    see all
  • Function

    Microtubule-associated force-producing protein involved in producing microtubule bundles and able to bind and hydrolyze GTP. Most probably involved in vesicular trafficking processes, in particular endocytosis.
  • Tissue specificity

    Ubiquitously expressed.
  • Involvement in disease

    Defects in DNM2 are a cause of centronuclear myopathy autosomal dominant (ADCNM) [MIM:160150]; also known as autosomal dominant myotubular myopathy. Centronuclear myopathies (CNMs) are congenital muscle disorders characterized by progressive muscular weakness and wasting involving mainly limb girdle, trunk, and neck muscles. It may also affect distal muscles. Weakness may be present during childhood or adolescence or may not become evident until the third decade of life. Ptosis is a frequent clinical feature. CNMs comprise a wide spectrum of phenotypes, ranging from severe neonatal to mild late-onset familial forms. The most prominent histopathologic features include high frequency of centrally located nuclei in muscle fibers not secondary to regeneration, radial arrangement of sarcoplasmic strands around the central nuclei, and predominance and hypotrophy of type 1 fibers.
    Defects in DNM2 are the cause of Charcot-Marie-Tooth disease dominant intermediate type B (CMTDIB) [MIM:606482]. Charcot-Marie-Tooth disease (CMT) is a clinically and genetically heterogeneous disorder of the peripheral nervous system, characterized by progressive weakness and atrophy, initially of the peroneal muscles and later of the distal muscles of the arms. CMTDIB is a form of Charcot-Marie-Tooth disease characterized by clinical and pathologic features intermediate between demyelinating and axonal peripheral neuropathies, and motor median nerve conduction velocities ranging from 25 to 45 m/sec.
  • Sequence similarities

    Belongs to the dynamin family.
    Contains 1 GED domain.
    Contains 1 PH domain.
  • Cellular localization

    Cytoplasm. Cytoplasm > cytoskeleton. Cell junction > synapse > postsynaptic cell membrane > postsynaptic density. Cell junction > synapse. Microtubule-associated. Also found in the postsynaptic density of neuronal cells.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132947 stained with Coomassie Blue

References

ab132947 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132947.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up