Recombinant Human DYNC1H1 protein (ab158297)

Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MISKMLKMQMLEDEDDLAYAETEKKTRTDSTSDGRPAWMRTLHTTASNWL HLIPQTLSHLKRTVENIKDPLFRFFEREVKMGAKLLQDVRQDLADVVQVC EGKKKQTNYLRTLINELVKGILPRSWSHYTVPAGMTVIQWVSDFSERIKQ LQNISLAAASGGAKELKVKALLTSLGWSAAVLGWGGSGSGEKHRAQV
    • Amino acids

      1 to 197
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158297 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • cytoplasmic dynein 1 heavy chain 1
    • cytoplasmic dynein heavy chain 1
    • DHC1
    • DHC1a
    • DKFZp686P2245
    • DNCH1
    • Dnchc1
    • DNECL
    • DYHC
    • dynein heavy chain, cytosolic
    • dynein, cytoplasmic 1, heavy chain 1
    • dynein, cytoplasmic-like
    • HL-3
    • KIAA0325
    • p22
    see all
  • Relevance

    Dyneins are a group of microtubule-activated ATPases that function as molecular motors. They are divided into two subgroups of axonemal and cytoplasmic dyneins. The cytoplasmic dyneins function in intracellular motility, including retrograde axonal transport, protein sorting, organelle movement, and spindle dynamics. Molecules of conventional cytoplasmic dynein are comprised of 2 heavy chain polypeptides and a number of intermediate and light chains. DYNC1H1 is a member of the cytoplasmic dynein heavy chain family which serves as a scaffold for the probable homodimeric assembly of the respective non-catalytic subunits.
  • Cellular localization

    Cytoplasmic, Golgi Apparatus, Microtubule.

Images

  • ab158297 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158297 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158297.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up