Overview

  • Product name
    Recombinant Human DYNC1I2 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSDKSELKAELERKKQRLAQIREEKKRKEEERKKKETDQKKEAVAPVQEE SDLEKKRREAEALLQSMGLTPESPIVPPPMSPSSKSVSTPSEAGSQDSGD GAVGSRRGPIKLGMAKITQVDFPPREIVTYTKETQTPVMAQPKEDEEEDD DVVAPKPPIEPEEEKTLKKDEENDSKAPPHELTEEEKQQILHSEEFLSFF DHSTRIVERALSEQINIFFDYSGRDLEDKEGEIQAGAKLSLNRQFFDERW SKHRVVSCLDWSSQYPELLVASYNNNEDAPHEPDGVALVWNMKYKKTTPE YVFHCQSAVMSATFAKFHPNLVVGGTYSGQIVLWDNRSNKRTPVQRTPLS AAAHTHPVYCVNVVGTQNAHNLISISTDGKICSWSLDMLSHPQDSMELVH KQSKAVAVTSMSFPVGDVNNFVVGSEEGSVYTACRHGSKAGISEMFEGHQ GPITGIHCHAAVGAVDFSHLFVTSSFDWTVKLWTTKNNKPLYSFEDNADY VYDVMWSPTHPALFACVDGMGRLDLWNLNNDTEVPTASISVEGNPALNRV RWTHSGREIAVGDSEGQIVIYDVGEQIAVPRNDEWARFGRTLAEINANRA DAEEEAATRIPA
    • Amino acids
      1 to 612
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158300 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • Cytoplasmic dynein 1 intermediate chain 2
    • Cytoplasmic dynein intermediate chain 2
    • cytosolic
    • DC1I2_HUMAN
    • DH IC 2
    • DH IC-2
    • DNCI2
    • DNCIC2
    • Dync1i2
    • Dynein intermediate chain 2
    • Dynein intermediate chain 2, cytosolic
    • Dynein, cytoplasmic, intermediate polypeptide 2
    • IC2
    see all
  • Function
    Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. The intermediate chains mediate the binding of dynein to dynactin via its 150 kDa component (p150-glued) DCNT1. Involved in membrane-transport, such as Golgi apparatus, late endosomes and lysosomes.
  • Sequence similarities
    Belongs to the dynein intermediate chain family.
    Contains 7 WD repeats.
  • Post-translational
    modifications
    Phosphorylated upon DNA damage, probably by ATM or ATR. The phosphorylation status of Ser-90 appears to be involved in dynactin-dependent target binding.
  • Cellular localization
    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • ab158300 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158300 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158300.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up