Description

  • Product name

    Recombinant Human Dynein protein
  • Purity

    > 90 % SDS-PAGE.
    ab108119 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMSDRKAVIKNADMSEDMQQDAVDCATQAME KYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQ VAILLFKSG
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      1 to 89
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab108119 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 30% Glycerol, 1.16% Sodium chloride

General Info

  • Alternative names

    • 8 kDa dynein light chain b
    • C87222
    • cytoplasmic
    • Dlc2
    • DLC8b
    • DNCL1B
    • DYL2_HUMAN
    • Dynein light chain 2
    • Dynein light chain 2, cytoplasmic
    • Dynein light chain LC8 type 2
    • Dynein light chain LC8-type 2
    • Dynll2
    • MGC17810
    • MGC72334
    see all
  • Function

    Acts as one of several non-catalytic accessory components of the cytoplasmic dynein 1 complex that are thought to be involved in linking dynein to cargos and to adapter proteins that regulate dynein function. Cytoplasmic dynein 1 acts as a motor for the intracellular retrograde motility of vesicles and organelles along microtubules. May play a role in changing or maintaining the spatial distribution of cytoskeletal structures.
  • Sequence similarities

    Belongs to the dynein light chain family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab108119 at approximately 12.5kDa (3µg).

References

ab108119 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab108119.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up