Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      DNRTYRYSNRYCGGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQA PASASSLPGTGAQLPPQPRYLGRPPSPTSPPPPELMDVSLV
    • Amino acids
      479 to 569
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160360 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AOMS3
    • Dual specificity tyrosine (Y) phosphorylation regulated kinase 1B
    • Dual specificity tyrosine phosphorylation regulated kinase 1B
    • Dual specificity tyrosine-phosphorylation-regulated kinase 1B
    • DYR 1B
    • DYR1A
    • DYR1B
    • DYR1B_HUMAN
    • DYRK 1B
    • Dyrk1b
    • Minibrain related kinase
    • Minibrain-related kinase
    • MIRK
    • Mirk protein kinase
    see all
  • Function
    Dual-specificity kinase which possesses both serine/ threonine and tyrosine kinase activities. Enhances the transcriptional activity of TCF1/HNF1A and FOXO1. Inhibits epithelial cell migration. Mediates colon carcinoma cell survival in mitogen-poor environments.
  • Tissue specificity
    Highest expression in skeletal muscle, testis, heart and brain with little expression in colon or lung. Expressed in a variety of tumor cell lines.
  • Sequence similarities
    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications
    Autophosphorylated on tyrosine residues. Phosphorylated by MAP kinase. Tyrosine phosphorylation may be required for dimerization.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab160360 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160360 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160360.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up