Description

  • Product name

    Recombinant human Dyrk1B/MIRK protein (Active)
    See all Dyrk1B/MIRK proteins and peptides
  • Biological activity

    The specific activity of ab207116 was determined to be 550 nmol/min/mg.

  • Purity

    > 90 % Densitometry.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSV DLIKTYKHINEVYYAKKKRRAQQAPPQDSSNKKEKKVLNHGYDDDNHDYI VRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIKIIKNKKAFLN QAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDL LRNTHFRGVSLNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNP KRSAIKIVDFGSSCQLGQRIYQYIQSRFYRSPEVLLGTPYDLAIDMWSLG CILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERL PGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPAD YLRFQDLVLRMLEYEPAARISPLGALQHGFFRRTADEATNTGPAGSSAST SPAPLDTCPSSSTASSISSSGGSSGSSSDNRTYRYSNRYCGGPGPPITDC EMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLG RPPSPTSPPPPELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGR PPLPPPDDPATLGPHLGLRGVPQSTAASS
    • Predicted molecular weight

      106 kDa including tags
    • Amino acids

      1 to 629
    • Tags

      GST tag N-Terminus
    • Additional sequence information

      BC018751

Specifications

Our Abpromise guarantee covers the use of ab207116 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

     This product was previously labelled as Dyrk1B

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.87% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 0.002% PMSF, 25% Glycerol

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • AOMS3
    • Dual specificity tyrosine (Y) phosphorylation regulated kinase 1B
    • Dual specificity tyrosine phosphorylation regulated kinase 1B
    • Dual specificity tyrosine-phosphorylation-regulated kinase 1B
    • DYR 1B
    • DYR1A
    • DYR1B
    • DYR1B_HUMAN
    • DYRK 1B
    • Dyrk1b
    • Minibrain related kinase
    • Minibrain-related kinase
    • MIRK
    • Mirk protein kinase
    see all
  • Function

    Dual-specificity kinase which possesses both serine/ threonine and tyrosine kinase activities. Enhances the transcriptional activity of TCF1/HNF1A and FOXO1. Inhibits epithelial cell migration. Mediates colon carcinoma cell survival in mitogen-poor environments.
  • Tissue specificity

    Highest expression in skeletal muscle, testis, heart and brain with little expression in colon or lung. Expressed in a variety of tumor cell lines.
  • Sequence similarities

    Belongs to the protein kinase superfamily. CMGC Ser/Thr protein kinase family. MNB/DYRK subfamily.
    Contains 1 protein kinase domain.
  • Post-translational
    modifications

    Autophosphorylated on tyrosine residues. Phosphorylated by MAP kinase. Tyrosine phosphorylation may be required for dimerization.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab207116 by densitometry, approximate MW 106 kDa.

  • The specific activity of ab207116 was determined to be 550 nmol/min/mg.

References

ab207116 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207116.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up