Recombinant Human Dystonin/BPA protein (ab117061)
Key features and details
- Expression system: Wheat germ
- Suitable for: WB, SDS-PAGE, ELISA
Description
-
Product name
Recombinant Human Dystonin/BPA protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS -
Predicted molecular weight
37 kDa including tags -
Amino acids
401 to 500
-
Specifications
Our Abpromise guarantee covers the use of ab117061 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
SDS-PAGE
ELISA
-
Form
Liquid -
Additional notes
This product was previously labelled as Dystonin.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.3% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- 230 kDa bullous pemphigoid antigen
- 230/240 kDa bullous pemphigoid antigen
- BP230
see all -
Relevance
Cytoskeletal linker protein. Acts as an integrator of intermediate filaments, actin and microtubule cytoskeleton networks. Required for anchoring either intermediate filaments to the actin cytoskeleton in neural and muscle cells or keratin-containing intermediate filaments to hemidesmosomes in epithelial cells. The proteins may self-aggregate to form filaments or a two-dimensional mesh. Isoform 3: plays a structural role in the assembly of hemidesmosomes of epithelial cells; anchors keratin-containing intermediate filaments to the inner plaque of hemidesmosomes. Required for the regulation of keratinocyte polarity and motility; mediates integrin ITGB4 regulation of RAC1 activity. Isoform 6: required for bundling actin filaments around the nucleus By similarity. Isoform 7: regulates the organization and stability of the microtubule network of sensory neurons to allow axonal transport. -
Cellular localization
Cytoplasm › cytoskeleton.
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
-
Datasheet download
References (0)
ab117061 has not yet been referenced specifically in any publications.