Description

  • Product name

    Recombinant Human Dystonin/BPA protein
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EDKLILAGNALQSDSKRLESGVQFQNEAEIAGYILECENLLRQHVIDVQI LIDGKYYQADQLVQRVAKLRDEIMALRNECSSVYSKGRILTTEQTKLMIS
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      401 to 500

Specifications

Our Abpromise guarantee covers the use of ab117061 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.

     This product was previously labelled as Dystonin

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.3% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 230 kDa bullous pemphigoid antigen
    • 230/240 kDa bullous pemphigoid antigen
    • BP230
    • BP240
    • BPA
    • BPAG1
    • Bullous pemphigoid antigen
    • Bullous pemphigoid antigen 1
    • DMH
    • DST
    • DT
    • Dystonia musculorum protein
    • Hemidesmosomal plaque protein
    • KIAA0728
    see all
  • Relevance

    Cytoskeletal linker protein. Acts as an integrator of intermediate filaments, actin and microtubule cytoskeleton networks. Required for anchoring either intermediate filaments to the actin cytoskeleton in neural and muscle cells or keratin-containing intermediate filaments to hemidesmosomes in epithelial cells. The proteins may self-aggregate to form filaments or a two-dimensional mesh. Isoform 3: plays a structural role in the assembly of hemidesmosomes of epithelial cells; anchors keratin-containing intermediate filaments to the inner plaque of hemidesmosomes. Required for the regulation of keratinocyte polarity and motility; mediates integrin ITGB4 regulation of RAC1 activity. Isoform 6: required for bundling actin filaments around the nucleus By similarity. Isoform 7: regulates the organization and stability of the microtubule network of sensory neurons to allow axonal transport.
  • Cellular localization

    Cytoplasm › cytoskeleton.

Images

  • 12.5% SDS-PAGE showing ab117061 at approximately 36.63 kDa.
    Stained with Coomassie Blue.

References

ab117061 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab117061.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up