Recombinant Human dystrophia myotonica containing WD repeat motif protein (ab158293)

Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MLLRGLMKSYFGGLLCVCWSPDGRYVVTGGEDDLVTVWSFTEGRVVARGH GHKSWVNAVAFDPYTTRAEEAATAAGADGERSGEEEEEEPEAAGTGSAGG APLSPLPKAGSITYRFGSAGQDTQFCLWDLTEDVLYPHPPLARTRTLPGT PGTTPPAASSSRGGEPGPGPLPRSLSRSNSLPHPAGGGKAGGPGVAAEPG TPFSIGRFATLTLQERRDRGAEKEHKRYHSLGNISRGGSGGSGSGGEKPS GPVPRSRLDPAKVLGTALCPRIHEVPLLEPLVCKKIAQERLTVLLFLEDC IITACQEGLICTWARPGKAGISSQPGNSPSGTVV
    • Amino acids
      1 to 334
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158293 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • D19S593E
    • DM 9
    • DM9
    • DMR N9
    • DMR N9 protein
    • DMRN 9
    • DMRN9
    • DMWD
    • DMWD_HUMAN
    • Dystrophia myotonica containing WD repeat motif
    • Dystrophia myotonica containing WD repeat motif protein
    • Dystrophia myotonica WD repeat containing protein
    • Dystrophia myotonica WD repeat-containing protein
    • Dystrophia myotonica-containing WD repeat motif protein
    • Gene59
    • Protein 59
    • Protein DMR-N9
    see all
  • Function
    Could have a regulatory function in meiosis.
  • Tissue specificity
    Strongest expression in brain, liver, and testis. Also expressed in kidney and spleen.
  • Sequence similarities
    Contains 5 WD repeats.
  • Information by UniProt

Images

  • ab158293 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158293 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158293.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up