Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGKPARKGCEWKRFLKNNWVLLSTVAAVVLGITTGVLVREHSNLSTLEKF YFAFPGEILMRMLKLIILPLIISSMITGVAALDSNVSGKIGVRAVVYYFC TTLIAVILGIVLVVSIKPGVTQKVGEIARTGSTPEVSTVDAMLDLIRNMF PENLVQACFQQYKTKREEVKPPSDPEMNMTEESFTAVMTTAISKNKTKEY KIVGMYSDGINVLGLIVFCLVFGLVIGKMGEKGQILVDFFNALSDATMKI VQIIMCYMPLGILFLIAGKIIEVEDWEIFRKLGLYMATVLTGLAIHSIVI LPLIYFIVVRKNPFRFAMGMAQALLTALMISSSSATLPVTFRCAEENNQV DKRITRFVLPVGATINMDGTALYEAVAAVFIAQLNDLDLGIGQIITISIT ATSASIGAAGVPQAGLVTMVIVLSAVGLPAEDVTLIIAVDWLLDRFRTMV NVLGDAFGTGIVEKLSKKELEQMDVSSEVNIVNPFALESTILDNEDSDTK KSYVNGGFAVDKSDTISFTQTSQF
    • Molecular weight

      83 kDa including tags
    • Amino acids

      1 to 542

Specifications

Our Abpromise guarantee covers the use of ab132484 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • EAA3_HUMAN
    • EAAC 1
    • EAAC1
    • EAAT 3
    • Excitatory amino acid carrier 1
    • Excitatory amino acid carrier1
    • Excitatory amino acid transporter 3
    • Excitatory amino acid transporter3
    • Excitatory amino-acid carrier 1
    • GLUTAMATE TRANSPORTER, HIGH-AFFINITY
    • MEAAC 1
    • MEAAC1
    • Neuronal and epithelial glutamate transporter
    • REAAC 1
    • REAAC1
    • Slc1 a1
    • Slc1a 1
    • SLC1A1
    • Sodium dependent glutamate/aspartate transporter 3
    • Sodium-dependent glutamate/aspartate transporter 3
    • Solute carrier family 1 (neuronal / epithelial high affinity glutamate transporter, system Xag), member 1
    • SOLUTE CARRIER FAMILY 1 (NEURONAL/EPITHELIAL HIGH AFFINITY GLUTAMATE TRANSPORTER), MEMBER 1
    • Solute carrier family 1 (neuronal/epithelial high affinity glutamate transporter, system Xag), member 1
    • Solute carrier family 1 member 1
    • Solute carrier family 1, member 1
    see all
  • Function

    Transports L-glutamate and also L- and D-aspartate. Essential for terminating the postsynaptic action of glutamate by rapidly removing released glutamate from the synaptic cleft. Acts as a symport by cotransporting sodium. Negatively regulated by ARL6IP5.
  • Tissue specificity

    Expressed in all tissues tested including liver, muscle, testis, ovary, retinoblastoma cell line, neurons and brain (in which there was dense expression in substantia nigra, red nucleus, hippocampus and in cerebral cortical layers).
  • Sequence similarities

    Belongs to the sodium:dicarboxylate (SDF) symporter (TC 2.A.23) family. SLC1A1 subfamily.
  • Post-translational
    modifications

    Glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132484 stained with Coomassie Blue

References

ab132484 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132484.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up